KEGG   Bradyrhizobium sp. BTAi1: BBta_6448Help
Entry
BBta_6448         CDS       T00528                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBta_6448 (bchD)
Enzymes [BR:bbt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BBta_6448 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6717473..6719215)
Genome map
AA seq 580 aa AA seqDB search
MSDGAAIWADAMIAAALAAIDPAAASVMLRAGAGPVREQWLELLRELTPATTVLRKLPPS
ISDDRLLGGLDLAATLQAGRPVMQRGLLAELHDGMLIAVMAERIAPSTVAHLTAALDTGM
ISIERDGLSLRAPARFGLIALDEGIGDEHVSPALADRLACHLDLGMVARADLGESLFTSS
DIAAARALLPQVGLSDEAIAALTTTACALGIDSLRAPLLACRIARIAAALDGATDVAESH
IACAARLVLAPRATRLPAADDETETNEAPEPENDPAENEEDDRSEDGPLEDRVLEAAQAA
IPADLLKRLQEERATRLRSSSASKQGTTQKAPKRGRPIGARRGEWRAGARLNVLETLRAA
APWQPLRRAQRSGKSGRLIVHKDDIRLTRFKQRSGTTTIFVVDASGSSALQRLAEVKGAV
ELLLAECYIRRDEVALIAFRGKGAELLLPPTRSLTRAKRSLAALPGGGGTPLSAAIFAAT
ELALAVKAKGQAPTIVLMTDGRANVARDGVGGRSEAEAEALVAARQLALTGIPVVLVDSS
PRPQDKAAQLAGAMQARYVALPHADAARLSQAVMAEASRG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacggcgccgcgatctgggccgatgcgatgatcgcagccgcgctggctgcgatc
gatccggcggcggcgtcagtgatgttgcgtgcaggcgcggggccggtgcgcgagcagtgg
ctcgaactgctacgcgagctgacgccggcgacgacggttcttcgcaagctcccgccgtcc
atctccgatgatcgcctgctcggcgggctcgatctcgccgccaccttgcaggccggccgt
ccggtgatgcagcgcgggctgctcgccgagcttcatgacggcatgctgatcgccgtcatg
gccgagcggatcgcgccgtcgaccgtcgcccatctcacggccgcgctcgataccggcatg
atcagcatcgagcgcgatggcctgtcgctgcgcgcgccggcgcggttcggcctgatcgcg
ctcgacgaggggattggcgatgagcacgtgtcgccggcactcgccgaccgcctggcctgt
catctcgatcttgggatggtcgcccgcgccgatctcggcgagagcctgttcacatcctcg
gacatcgcggctgcgcgggcgctgctgccgcaggtcggtctgtccgacgaagccatcgcg
gcgctgacgacgacggcgtgcgcgctcggcatcgactcgctgcgcgcgccgctgctggcg
tgtcggattgcgcgcatcgcagcggcgctggatggcgcgaccgatgtcgcggaatctcac
atcgcgtgcgccgcgcggctggtgctggcgccgcgtgcgacgcggctgcctgcagcggat
gacgagaccgagaccaacgaggcgccggagcctgagaacgacccggccgagaacgaggag
gacgaccgcagcgaggacggtccgctcgaggatcgcgtgctcgaggcagcgcaggcggcc
attccggctgatctgctcaagcgcctgcaggaggagcgcgcgacccgcctccgcagcagt
agcgccagcaagcagggcaccacgcaaaaggcgccgaagcgcggccgtcccattggcgca
cgccgcggcgagtggcgggcgggcgcgcggctcaacgtgctcgaaactttgcgcgcggcg
gcgccttggcagccgctgcggcgggcgcagcgctccggcaagagcggccggctgatcgtg
cacaaggacgacatccgcctcacgcgcttcaagcagcgctcgggcaccacgacgatcttc
gtcgtcgacgcctccggctcctcggcgctgcagcggcttgccgaagtgaagggcgctgtc
gagctgctgctcgccgaatgctacatccgccgcgacgaggtcgcgctgatcgcatttcgc
ggcaagggcgccgagctgctgctgccgccgacccgctcgctgacccgcgccaagcgcagc
ttggcagcgcttcccggcggcggcggcacgccgctgtcggcggcgatctttgctgccacc
gagctcgcgcttgccgtgaaggccaagggacaggcgccgaccatcgtgctgatgaccgac
ggccgcgccaatgtcgcccgcgatggtgtcggcggacgcagcgaggcggaggcggaggcg
ctggtggccgccaggcagctcgcgctcaccggcatccccgtggtgctggtcgattcctcg
ccccgcccgcaggacaaggcggcgcaattggccggcgcgatgcaggcccgctacgtcgcg
ctgcctcatgccgacgcggcgcggttgtcgcaggcggtgatggccgaggccagccgcggc
tga

DBGET integrated database retrieval system