KEGG   Bradyrhizobium sp. BTAi1: BBta_6449Help
Entry
BBta_6449         CDS       T00528                                 

Gene name
bchI
Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bbt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(6719212..6720258)
Genome map
AA seq 348 aa AA seqDB search
MGIAFPFAAIVGQDEMKLALMIAAVDPKVGGVLAFGDRGAGKSTAVRALAALLPPMSAVV
GCPYQCDPADAAAQCAECRARSKPSGKAKKPAALKAHQVPVPVVDLPLGATEDRVVGALD
LERALAHGEKSFEPGLLARANRGFLYIDEVNLLEDHLVDLLLDVAASGENVVERDGLSIR
HPARLVLVGTGNPEEGELRPQLLDRFGLSVEVKTPADLPTRIEVIKRRDAFETDPAAFVA
HWEKEEAKQRKRILAAREHIASVKVADRELENAARLCMALGTDGLRGELTLMRAARAAAA
LDGAKAVDDGHLKTVAPMALRHRLRRNPLDDSGSSVRVERALNELFAT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgcctttccgttcgcggccatcgtcggccaggacgagatgaagctggcgctg
atgatcgccgccgtcgatccgaaggtcggcggcgtgctggcgttcggtgatcgcggcgct
ggcaagtccactgcggtgcgtgcgcttgccgcattgctgccgccgatgagcgccgtcgtc
ggctgtccctaccaatgcgatccggccgatgccgccgcgcaatgcgcggagtgccgcgcg
cgatccaagccgagcggcaaggcgaagaagccggccgcgctcaaagcacaccaggtgccg
gtgccggtggtcgacctgccgctcggcgcgaccgaggaccgtgtcgtcggcgcactcgat
ttggagcgtgcgctggcgcatggcgagaaatcgttcgagccggggctgctggcgcgcgcc
aatcgcggctttctctatatcgacgaggtcaatctgctcgaggatcatctcgtcgatctc
ctgctcgacgtcgcggcatcaggcgagaacgtggtcgagcgcgacggtctcagcatccgt
catcccgcgcggctcgtgctggtcggcaccggcaatccggaggagggcgagttgcgaccg
caattgctcgatcgcttcgggctctcggtcgaggtcaagacgcccgccgatctgccgacg
cgcatcgaggtgatcaagcgccgcgatgcgttcgagaccgatcccgcagccttcgtcgcg
cattgggagaaggaggaggcgaagcagcgcaagcgcatcctcgccgctcgcgagcatatc
gcctcggtcaaggtcgccgaccgcgagctggaaaacgcggcgcggctgtgcatggcgctc
ggcacggatggtctgcgtggcgagctcaccctgatgcgagcggcgcgcgccgccgccgcg
ctcgatggcgcgaaggcggtcgatgacggccatctcaagaccgtggcgccgatggcgctg
cggcaccgtctgcggcgcaatccgctcgacgattccggctcctcggtgcgggtcgagcgc
gcgctcaacgagctgttcgcaacgtga

DBGET integrated database retrieval system