KEGG   Bradyrhizobium sp. BTAi1: BBta_6478Help
Entry
BBta_6478         CDS       T00528                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00010  Glycolysis / Gluconeogenesis
bbt00052  Galactose metabolism
bbt00500  Starch and sucrose metabolism
bbt00520  Amino sugar and nucleotide sugar metabolism
bbt00521  Streptomycin biosynthesis
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
Module
bbt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bbt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_6478 (glk)
   00052 Galactose metabolism
    BBta_6478 (glk)
   00500 Starch and sucrose metabolism
    BBta_6478 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BBta_6478 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBta_6478 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BBta_6478 (glk)
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBta_6478 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABQ38387
RhizoBase: BBta_6478
UniProt: A5EQE3
Position
6748912..6749892
Genome map
AA seq 326 aa AA seqDB search
MSDRVLLGDIGGTNARFALLDGGTIDHVEHLKVADYPTIDDAITEFLARHAAGGAPGAAV
LDIAGPIERNRGMLTNSTWVIDGAELKARFNLRSARLLNDFEAVGWSLPALHPDDLFPLG
GDAAVAGAPMLVIGPGTGFGAACYLPGDGRPMVAVTEAGHATLPATTAREAAVLAKMRER
FGHVSIERALSGMGLENVYRAVAAVDGVTVPPRDAAAITSAALDGSCTTSRATLDMFCAW
LGAVAGNLTLTFCARGGVYIAGGIPPRFPDYFARSDFRRQFESKGRYDSYLRPIPVHLVT
KPDISFLGLKSFYESVIPASGGAPTR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgcgtgcttctgggggacatcggcggcaccaatgcgcgctttgcgctgctt
gacggaggcacgatcgaccatgtcgaacacctgaaggtcgcagactatccgaccatcgat
gatgccatcaccgagttcctggcccggcatgcggccggcggggcacccggcgcggccgtg
ctcgacattgccggtccgatcgagcgcaaccgcggcatgctgaccaattcgacctgggtg
atcgacggggccgagctcaaggcgcgcttcaatctgcgctcggcaaggctcctcaacgat
ttcgaggccgtcggctggtcgctgccggcgctgcatccggacgatctgtttccgctcggc
ggcgacgcagccgttgctggcgcgccgatgctggtgatcggcccgggcacaggattcggc
gccgcctgctatctcccgggcgacggccgtcccatggtggccgtgaccgaagctggccac
gccacgctgccggcgacgaccgcgcgcgaggccgcggtgctggccaagatgcgcgagcgc
ttcggccatgtctcgatcgagcgggcgctctcgggcatggggctcgagaacgtctaccgg
gccgttgccgccgtcgatggcgtcacagtgccgccgcgcgatgcggccgcgatcaccagc
gccgcgctcgacggcagctgcacgaccagccgcgcgacgctcgacatgttctgcgcctgg
ctcggcgccgtcgccggcaatctgaccttgacgttctgcgcccgcggcggcgtctatatc
gccggcggcatcccgccgcgctttcccgactatttcgccaggtccgatttccgccggcag
ttcgagagcaagggacgctatgacagctatctgcgtccgatcccggtgcacctcgtcacc
aagccggatatcagcttccttggtctcaaatcgttctatgaatccgtcattcccgcgagc
ggcggcgctcccacacgctga

DBGET integrated database retrieval system