KEGG   Bradyrhizobium sp. BTAi1: BBta_6479Help
Entry
BBta_6479         CDS       T00528                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBta_6479
   01230 Biosynthesis of amino acids
    BBta_6479
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBta_6479
   00030 Pentose phosphate pathway
    BBta_6479
   00051 Fructose and mannose metabolism
    BBta_6479
   00052 Galactose metabolism
    BBta_6479
  Energy metabolism
   00680 Methane metabolism
    BBta_6479
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BBta_6479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
6749899..6750837
Genome map
AA seq 312 aa AA seqDB search
MSDIVTITPNPAVDVSTTVERIMPVAKLRGTTQQRDPGGGGINVARVITRLGGDVTALYP
VGGPTGQLLKQLVESEGVTSLTWTTAEHTREDFFVQERATAQPYRFILPGPTLSESEWQA
GLALLARIDPFPRFVVGSGSLPRGVPTDYYARIAALVRARGAQFILDTSGPALAAAVAGG
VDLIKPSLREMQELAGGELPDAAAWERAARALVASGKAGTVALTMGHLGALLVTSERVLR
AQPLTMVPVNAVGAGDSFLGALVAKLAAGAPLEDAFRFAVAAGAAALLRTGTALCDPSDV
NRLLADVRLETA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatcgtcacgatcacgccgaacccggctgtcgacgtctcgacgaccgtcgag
aggatcatgccggtagcgaagctgcgcggcaccacgcagcagcgtgatcccggcggcggc
ggcatcaatgtcgcgcgcgtgatcacccgcctcggcggcgatgtgaccgcgctctatccc
gtgggcgggccgaccgggcagctgttgaagcagctcgtggagagcgaaggcgtcaccagc
ctcacctggacaacagccgagcacacgcgcgaggactttttcgtgcaggagcgcgccacg
gcccagccctaccgcttcatccttcccggaccgacgctgtctgaaagcgagtggcaggct
ggtctcgcgctgctcgcccgcatcgatccattcccccgcttcgtggtcggcagcggcagc
ctgccgcgcggggtcccgaccgattactacgcccgcattgccgcgctcgtccgcgcccgc
ggcgcgcagttcatcctcgacacatcgggcccggccctggccgcggccgtcgccggcggc
gtcgacctgatcaagccgtcgctgcgcgagatgcaggagctcgccggcggcgaactgccc
gatgcggcggcatgggaacgagcggcgcgggcgctggtcgcaagcggcaaggccggcacg
gtcgcgctcaccatgggccatctcggcgcgctcttggtgacatcagagcgcgtgctgcgc
gcccagccgctgaccatggtgccggtcaacgccgtcggcgccggtgacagctttctcggc
gcgctggtggcgaagctcgcggcaggtgcaccactggaggacgcgttccgcttcgcggtt
gcggccggcgcggcagcgttgctgcgtaccggcaccgcgctatgcgatccgtccgatgtc
aaccgtctgctggctgacgtgcggctggagacggcgtaa

DBGET integrated database retrieval system