KEGG   Bradyrhizobium sp. BTAi1: BBta_6647Help
Entry
BBta_6647         CDS       T00528                                 

Definition
(GenBank) putative protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Enzymes [BR:bbt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BBta_6647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_18 Methyltransf_11 RrnaAD MTS Methyltransf_12 Ubie_methyltran Methyltransf_32 CMAS Methyltransf_24 Methyltr_RsmB-F FtsJ Fibrillarin Methyltransf_9 GCD14 PrmA
Motif
Other DBs
NCBI-ProteinID: ABQ38547
RhizoBase: BBta_6647
UniProt: A5EQV3
Position
complement(6917531..6918364)
Genome map
AA seq 277 aa AA seqDB search
MSDVAAARRRYADEIARNEKITSPRLVQALATVPRERFLDQGPWRIRSGTVRDYWSTQSA
DPIHLYSDVLVAIDESRQLDTGLPSLWAHVFDVLDIKEGERVVQIGCGLGYYAAILSELV
GRRGTVIAIDCEEAFVARAEANLRDWRNVEVVHGDGFEAIPGPADVVVVHAGFGYPHQSW
IDSLGRTGRLLVPLTGPDRQGRVVKIARSPGGYRADTICGIEIFPCAGRGDPDGDAQLTA
WWAQASALSPLFCRDIERGLPSQVSTTPLRRKTRRSS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttgcggcggcccgccggcgttacgccgatgaaattgcgcgcaacgagaag
atcacatcgccgcgcttggtgcaggccttggccaccgttccccgcgagcgcttcctggac
cagggaccgtggcgcatccggagcggcacggtgcgcgactattggagcacgcaaagcgcg
gatccgatccatctgtattcggatgtgctcgtcgccatcgatgagagccgccagctcgat
acggggctgccgagcctgtgggcgcatgtgttcgacgtgctcgacatcaaggaaggcgag
cgcgtcgtgcagatcggatgtgggctgggctactacgcggcgatcttgtccgagctggtc
ggcaggcgtggaacggtcattgcgatcgactgtgaagaggcgttcgtcgcgcgcgccgaa
gccaatctgcgcgattggcgaaatgtcgaggtcgtgcatggcgacgggttcgaggcgata
cccgggccggccgatgtcgtcgtcgtccacgccgggttcggctatccacatcaatcgtgg
atcgattcgctcggacggaccggtcgtcttctggtgccgttgacggggccggacaggcag
gggcgggtggtcaagatcgcacggtcgccaggcggatatcgagcagatacgatctgcggg
atcgagatctttccgtgcgcagggcgcggcgatccggacggcgacgcgcagttgacagcg
tggtgggcgcaggcctccgctctctcgccgctgttttgtcgtgacattgaacgcggctta
ccctcgcaggtttcgacaacgccgctccggagaaagacccgcagatcgtcgtga

DBGET integrated database retrieval system