KEGG   Bradyrhizobium sp. BTAi1: BBta_6959Help
Entry
BBta_6959         CDS       T00528                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBta_6959 (galU)
   00052 Galactose metabolism
    BBta_6959 (galU)
   00500 Starch and sucrose metabolism
    BBta_6959 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BBta_6959 (galU)
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BBta_6959 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7295550..7296431)
Genome map
AA seq 293 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVFDEAKEAGIEHFVFVTGRNK
TAIEDHFDRMYELDATLAARGKKTEIEILARDQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGDEPFAVVLPDELVLNTPGCLAQMIAAANRLPEKSNLLAVQEVPADQTHQYGICGVGKR
DGKIFEVDGMVEKPAKGTAPSNFSITGRYILQPEIFKILATQERGAGGEIQLTDAMIGLS
KTQTFYGVDFDGERHDCGSKSGFLKANIAFGMARADLRDGLRADMKRYLEGKS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgcaaagccgtatttccggtcgccggtctcggtacccgcgtccttcccgcc
accaaggcgatgccgaaggagatgctgacgatcgtcgacaagccgctcatccagtacgtt
ttcgacgaagccaaggaagccggcatcgagcatttcgtcttcgtgaccgggcgcaacaag
accgcgatcgaggatcatttcgaccgcatgtatgagctcgacgcgacgctcgcggcgcgc
ggcaagaagaccgagatcgagatcctggcccgggatcagccggaggccggcgcggtcagc
ttcacccgtcagcaggcgccgctcggcctcggccatgcggtgtggtgcgcgcgcgacatc
gtcggcgacgagccgttcgcggtggtgctgccggacgagctggtgctgaacacgcccggc
tgtctcgcgcagatgatcgccgcggcaaacagactgcctgagaaaagcaatttgctcgcg
gtgcaggaggtgccggccgatcagacccaccaatacggcatttgcggcgtcggcaagcgc
gacggcaagatctttgaggtcgacggcatggtcgagaagcccgccaagggcacggcgccg
tcgaacttctcgatcaccgggcgctacatcctgcagccggagatcttcaagatcctggcg
acgcaggagcgtggcgccggcggcgagatccagctcaccgatgcgatgatcggcctgtcg
aagacgcagacattctatggcgtcgatttcgacggcgagcgccatgattgcggttcgaag
tccggtttcctgaaggccaacatcgccttcggcatggcccgtgccgatctgcgcgacggc
ctgcgcgcggacatgaagcgctacctcgaaggcaagagttga

DBGET integrated database retrieval system