KEGG   Bradyrhizobium sp. BTAi1: BBta_6959Help
Entry
BBta_6959         CDS       T00528                                 

Gene name
galU
Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00040  Pentose and glucuronate interconversions
bbt00052  Galactose metabolism
bbt00500  Starch and sucrose metabolism
bbt00520  Amino sugar and nucleotide sugar metabolism
bbt01100  Metabolic pathways
bbt01130  Biosynthesis of antibiotics
Module
bbt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBta_6959 (galU)
   00052 Galactose metabolism
    BBta_6959 (galU)
   00500 Starch and sucrose metabolism
    BBta_6959 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BBta_6959 (galU)
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BBta_6959 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABQ38846
RhizoBase: BBta_6959
UniProt: A5ERQ2
Position
complement(7295550..7296431)
Genome map
AA seq 293 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVFDEAKEAGIEHFVFVTGRNK
TAIEDHFDRMYELDATLAARGKKTEIEILARDQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGDEPFAVVLPDELVLNTPGCLAQMIAAANRLPEKSNLLAVQEVPADQTHQYGICGVGKR
DGKIFEVDGMVEKPAKGTAPSNFSITGRYILQPEIFKILATQERGAGGEIQLTDAMIGLS
KTQTFYGVDFDGERHDCGSKSGFLKANIAFGMARADLRDGLRADMKRYLEGKS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgcaaagccgtatttccggtcgccggtctcggtacccgcgtccttcccgcc
accaaggcgatgccgaaggagatgctgacgatcgtcgacaagccgctcatccagtacgtt
ttcgacgaagccaaggaagccggcatcgagcatttcgtcttcgtgaccgggcgcaacaag
accgcgatcgaggatcatttcgaccgcatgtatgagctcgacgcgacgctcgcggcgcgc
ggcaagaagaccgagatcgagatcctggcccgggatcagccggaggccggcgcggtcagc
ttcacccgtcagcaggcgccgctcggcctcggccatgcggtgtggtgcgcgcgcgacatc
gtcggcgacgagccgttcgcggtggtgctgccggacgagctggtgctgaacacgcccggc
tgtctcgcgcagatgatcgccgcggcaaacagactgcctgagaaaagcaatttgctcgcg
gtgcaggaggtgccggccgatcagacccaccaatacggcatttgcggcgtcggcaagcgc
gacggcaagatctttgaggtcgacggcatggtcgagaagcccgccaagggcacggcgccg
tcgaacttctcgatcaccgggcgctacatcctgcagccggagatcttcaagatcctggcg
acgcaggagcgtggcgccggcggcgagatccagctcaccgatgcgatgatcggcctgtcg
aagacgcagacattctatggcgtcgatttcgacggcgagcgccatgattgcggttcgaag
tccggtttcctgaaggccaacatcgccttcggcatggcccgtgccgatctgcgcgacggc
ctgcgcgcggacatgaagcgctacctcgaaggcaagagttga

DBGET integrated database retrieval system