KEGG   Bradyrhizobium sp. BTAi1: BBta_6971Help
Entry
BBta_6971         CDS       T00528                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bbt00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bbt00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7307942..7308733)
Genome map
AA seq 263 aa AA seqDB search
MTTNLKGKTAVVTGSTSGIGLAIARGFASAGANIVLNGFGAAADIEKERAAIESEFKVKA
VHSPADMSKPAEIAGMIALGESTFGAVDILVNNAGIQFVSPVEDFPPEKWEQIIAINLSS
AFYGIHAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVSAKHGIAGLTKTVALELATFK
ITCNCISPGYVWTPLVEKQIPDTMKARNLTKEQVINDVLLAAQPTKEFVTVDQVAALALF
LCSDEASQITGANLSIDGGWTAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaatttgaagggcaagaccgctgtggtgaccggctcgaccagcggcatcgga
ctcgccattgcgcgcggctttgccagcgccggggcgaacatcgtgctcaacggctttggc
gctgccgccgacatcgagaaggagcgcgccgccatcgagagcgagttcaaggtcaaggcc
gtgcattcgccggccgacatgagcaagccggccgagatcgccggcatgatcgcgctcggc
gagagcacgttcggtgcggtcgacatcctcgtcaacaatgccggcatccagttcgtctcg
ccggtcgaggacttcccgccggagaagtgggagcagatcatcgcgatcaatctctcctcg
gcgttctacggcatccacgccgccgtgcccggcatgaagaagcgcggctggggccgcatc
atcaacacggcgtccgcgcactcgctggtcgcctcgccgttcaagtcggcctatgtctcg
gccaagcacggcatcgccggtctgaccaagaccgtggcgctggagctcgcgaccttcaag
attacctgcaattgcatctcgccgggctatgtctggacgccgctggtcgagaagcagatc
cccgacaccatgaaggcgcgcaatctcaccaaggagcaggtcatcaacgacgtgctgctg
gcggcgcagccgaccaaggagttcgtgacggtcgatcaggtcgcagcgctggcgctgttc
ctgtgcagcgacgaggcgtcgcagatcaccggcgccaacctctcgatcgacggcggctgg
accgccgcgtaa

DBGET integrated database retrieval system