KEGG   Bradyrhizobium sp. BTAi1: BBta_6971Help
Entry
BBta_6971         CDS       T00528                                 

Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00072  Synthesis and degradation of ketone bodies
bbt00650  Butanoate metabolism
bbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BBta_6971
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BBta_6971
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BBta_6971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Alpha_GJ
Motif
Other DBs
NCBI-ProteinID: ABQ38858
RhizoBase: BBta_6971
UniProt: A5ERR4
Position
complement(7307942..7308733)
Genome map
AA seq 263 aa AA seqDB search
MTTNLKGKTAVVTGSTSGIGLAIARGFASAGANIVLNGFGAAADIEKERAAIESEFKVKA
VHSPADMSKPAEIAGMIALGESTFGAVDILVNNAGIQFVSPVEDFPPEKWEQIIAINLSS
AFYGIHAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVSAKHGIAGLTKTVALELATFK
ITCNCISPGYVWTPLVEKQIPDTMKARNLTKEQVINDVLLAAQPTKEFVTVDQVAALALF
LCSDEASQITGANLSIDGGWTAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaatttgaagggcaagaccgctgtggtgaccggctcgaccagcggcatcgga
ctcgccattgcgcgcggctttgccagcgccggggcgaacatcgtgctcaacggctttggc
gctgccgccgacatcgagaaggagcgcgccgccatcgagagcgagttcaaggtcaaggcc
gtgcattcgccggccgacatgagcaagccggccgagatcgccggcatgatcgcgctcggc
gagagcacgttcggtgcggtcgacatcctcgtcaacaatgccggcatccagttcgtctcg
ccggtcgaggacttcccgccggagaagtgggagcagatcatcgcgatcaatctctcctcg
gcgttctacggcatccacgccgccgtgcccggcatgaagaagcgcggctggggccgcatc
atcaacacggcgtccgcgcactcgctggtcgcctcgccgttcaagtcggcctatgtctcg
gccaagcacggcatcgccggtctgaccaagaccgtggcgctggagctcgcgaccttcaag
attacctgcaattgcatctcgccgggctatgtctggacgccgctggtcgagaagcagatc
cccgacaccatgaaggcgcgcaatctcaccaaggagcaggtcatcaacgacgtgctgctg
gcggcgcagccgaccaaggagttcgtgacggtcgatcaggtcgcagcgctggcgctgttc
ctgtgcagcgacgaggcgtcgcagatcaccggcgccaacctctcgatcgacggcggctgg
accgccgcgtaa

DBGET integrated database retrieval system