KEGG   Bradyrhizobium sp. BTAi1: BBta_6985Help
Entry
BBta_6985         CDS       T00528                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BBta_6985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7322758..7323747)
Genome map
AA seq 329 aa AA seqDB search
MSVTGVRLVVLCLGLLALPALAADKSVAPYLAAVEPKPTPPHFAAIVGKPLSLLAAAIGQ
KPKDPNRDPHRAAHQPPHAAAATEKPKAAPQVAAAAETPPAQLSEAELAAKGLQLFNDAS
LSGGSKASCATCHFSTGHTNNKTYVGLDVVADGDPNGRNTPTLWGVGERSVFGWAGQAAT
LEDSIRGIIVNRMKGPEPSKETLAALVAYVRTLKYPANWQLKEDGSPTADASAAVKRGYE
LYLGDGGCGTCHQLTSFDKKSRDDIGTGGKFKVPALRAVASTAPYFHDGRTASLREAVKM
MWEVYAKKMESRQPTDAELDDLTAYVGAL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgactggagtgcggttggtcgtgttgtgtcttggcctgctcgctctgcccgca
ctggcggccgacaagtccgttgcgccataccttgctgcggtagagccaaagccgacgccg
ccgcattttgctgccattgtgggaaagcccttgtcgctgcttgctgcggcgatagggcaa
aagcccaaggatccgaatcgggatccgcaccgggccgcgcatcagccgccgcatgcggcc
gcggcgacggagaagccgaaggcggcaccgcaggtcgctgctgccgctgagacgccgccg
gcccaactctccgaggcagagctcgcggccaaggggctgcagctgttcaacgacgccagc
ctgtccggcggcagcaaggcgtcctgcgcgacctgccacttctcgaccgggcataccaac
aacaagacctatgtcgggctcgacgtggtcgcagatggcgatcccaatggccgcaacacg
ccgacgctctggggcgtcggcgagcgctcggtgttcggctgggccggccaggctgcgacc
ctggaggacagcatccgcggcatcatcgtcaaccgcatgaagggaccggagccgtcgaag
gagaccttggcggccctggtcgcctatgtgcgcaccttgaaatatccggcgaattggcag
ctcaaggaggatggctcgccgacggccgacgccagcgcggcggtgaagcgtggctacgag
ctttatctcggcgatggcggctgtggcacctgccatcaactgacgagcttcgacaagaag
agccgcgacgacattggcaccggcggcaagttcaaggtgccggcgctgcgcgcggtggcg
tcgaccgcgccgtatttccacgacggccgcaccgcctcgctgcgcgaggcggtgaagatg
atgtgggaagtctacgccaagaagatggagtcgcggcagccgaccgacgccgagctcgac
gatctcaccgcctatgtcggtgcgctctga

DBGET integrated database retrieval system