KEGG   Bradyrhizobium sp. BTAi1: BBta_6991Help
Entry
BBta_6991         CDS       T00528                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBta_6991 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBta_6991 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BBta_6991 (glcB)
Enzymes [BR:bbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BBta_6991 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
7327036..7329198
Genome map
AA seq 720 aa AA seqDB search
MTRIDAHGLKIAPVLFDFIAKEAAPKTGIDPDAFWAGVAAILRDLAPKNRALLAYRDALQ
DKIDAWHLANKGKAFDLGAYKAFLKEIGYLLPEPATHKVETANVDEEIGKICGPQLVVPL
TNARYALNAANARWGSLYDAFYGTDAIPHDPSEGGKGYNKARGDKVIAKAKAFLDAAAPL
ATGSHTDVTAYSVIAGQLSAKLKSGNATALKDGAQFAGYQGSAEAPSVILLANNGLHIEV
VIDRSHVIGKDDPAGVSDMILEAAVSTILDMEDSVAAVDAEDKVLVYRNTLGLMNGTLSA
DFEKGGKTLTRALNSDRSYTTPSGGTLTLQGRSLLLIRNCGHHMFTDAVLDDKGEEVPEG
ILDAAVTGLLAIHDLKGHSKVKNSRTGSIYIVKPKMHGPDEVALTVELFARVEKLLGLPE
NSMKVGIMDEERRTTVNLKACIQQASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMK
AQPWIKSYEDWNVDMGLTCGLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPS
PTAATLHALHYHQVNVHARQAELTKGGPRAKLGDILTIPVSNSNWAPDDVRQEIDNNCQG
ILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKDQVMDSLKR
MAVVVDKQNAGDPLYKPMAPSFDGVAFKAACDLVFEGRTQPNGYTEYILTARRREAKAQA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgcccacggactgaagatcgccccggttttgttcgacttcatcgcc
aaggaggcggcacccaagacggggatcgatccggacgcgttctgggccggcgtcgccgcc
atcctgcgcgatctcgccccgaagaaccgcgcgctacttgcctaccgggacgccctgcag
gacaagatcgatgcctggcaccttgccaacaagggcaaggccttcgacctcggcgcctat
aaggcgtttttgaaggagatcgggtatctcctgccggagccggcgacccacaaggtcgag
accgccaatgtggacgaggagatcggcaagatctgcggcccgcagctggtggtgccgctg
accaacgcgcgctacgcgctgaacgccgcgaacgcacgctggggctcgctttacgacgcc
ttctacggcaccgacgccatcccgcatgatccgagcgagggcggaaagggctacaacaag
gcgcgcggcgacaaggtgatcgccaaggccaaggcgtttctcgacgcggctgcgccgctc
gccaccggcagccataccgacgtgaccgcctacagcgtgatcgcggggcagctctcggcc
aagctcaagagcggcaacgccacggcgctgaaggatggcgcgcagttcgcgggctaccag
ggttcggcggaagcgcccagcgtgatcctgctcgccaataacggcctgcacatcgaggtg
gtgatcgatcgcagccacgtcatcggcaaggacgatccggccggcgtctccgacatgatc
ctggaggccgcggtctcgaccattctcgacatggaggactcggtcgccgcggtcgatgcc
gaggacaaggtgctggtctatcgcaacacgctcggcctgatgaacggcacgctctcggcc
gatttcgagaagggcggcaagacgctgacccgcgcgctgaacagcgaccgcagctacacc
acgccgtccggcggcacgctgactttgcaagggcgcagcctgctgctgatccgcaattgc
ggacatcacatgttcaccgacgccgtgctcgacgacaagggcgaggaggtgccggaaggc
attctcgacgctgccgtgaccggcctgctggcgatccacgacctcaagggccattccaag
gtcaagaacagccgcaccggctcgatctacatcgtcaagccgaagatgcacggccccgac
gaggtcgcgctcacggtcgaattgttcgcgcgcgtcgagaagctgctcggcctgcccgag
aacagcatgaaggtcggaatcatggacgaggagcgccgcaccacggtgaacctcaaggcc
tgcatccagcaggcttccaagcgcatcgtgttcatcaataccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagcgggcccgatgatccgcaagaacgagatgaag
gcgcagccctggatcaagtcctatgaggattggaacgtcgacatgggcctgacctgcggc
cttccgggccacgcccagatcggcaagggcatgtgggccgcgccggacaagatggcggac
atgctggcgcagaagatcggccatccgcaggcgggcgcgaccaccgcctgggtgccgtca
ccaaccgcggcgacgctgcatgccctgcactatcaccaggtcaacgtgcacgcccgtcag
gccgagctcaccaagggcggcccgcgcgccaagctcggcgacatcctcaccattccggtg
tcgaactcgaactgggcccccgacgacgtccgccaggagatcgacaacaactgccagggc
attctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgccggac
atccacgatgtcggcctgatggaggatcgtgcgaccttgcgcatctccagccagcatctt
gccaactggctgcaccatggcgtcgtcaccaaggaccaggtgatggactcgctgaagcgc
atggccgtggtggtcgacaagcagaatgccggagatccgctctacaagccgatggcgccg
tcattcgatggcgtcgcgttcaaggcggcgtgcgatctggtgttcgaaggtcgcacccag
cccaacggctacaccgagtacatcctgaccgcgcggcgccgtgaggcaaaagcgcaggcc
tga

DBGET integrated database retrieval system