KEGG   Bradyrhizobium sp. BTAi1: BBta_6991Help
Entry
BBta_6991         CDS       T00528                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bbt01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbt00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bbt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
7327036..7329198
Genome map
AA seq 720 aa AA seqDB search
MTRIDAHGLKIAPVLFDFIAKEAAPKTGIDPDAFWAGVAAILRDLAPKNRALLAYRDALQ
DKIDAWHLANKGKAFDLGAYKAFLKEIGYLLPEPATHKVETANVDEEIGKICGPQLVVPL
TNARYALNAANARWGSLYDAFYGTDAIPHDPSEGGKGYNKARGDKVIAKAKAFLDAAAPL
ATGSHTDVTAYSVIAGQLSAKLKSGNATALKDGAQFAGYQGSAEAPSVILLANNGLHIEV
VIDRSHVIGKDDPAGVSDMILEAAVSTILDMEDSVAAVDAEDKVLVYRNTLGLMNGTLSA
DFEKGGKTLTRALNSDRSYTTPSGGTLTLQGRSLLLIRNCGHHMFTDAVLDDKGEEVPEG
ILDAAVTGLLAIHDLKGHSKVKNSRTGSIYIVKPKMHGPDEVALTVELFARVEKLLGLPE
NSMKVGIMDEERRTTVNLKACIQQASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMK
AQPWIKSYEDWNVDMGLTCGLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPS
PTAATLHALHYHQVNVHARQAELTKGGPRAKLGDILTIPVSNSNWAPDDVRQEIDNNCQG
ILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKDQVMDSLKR
MAVVVDKQNAGDPLYKPMAPSFDGVAFKAACDLVFEGRTQPNGYTEYILTARRREAKAQA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgcccacggactgaagatcgccccggttttgttcgacttcatcgcc
aaggaggcggcacccaagacggggatcgatccggacgcgttctgggccggcgtcgccgcc
atcctgcgcgatctcgccccgaagaaccgcgcgctacttgcctaccgggacgccctgcag
gacaagatcgatgcctggcaccttgccaacaagggcaaggccttcgacctcggcgcctat
aaggcgtttttgaaggagatcgggtatctcctgccggagccggcgacccacaaggtcgag
accgccaatgtggacgaggagatcggcaagatctgcggcccgcagctggtggtgccgctg
accaacgcgcgctacgcgctgaacgccgcgaacgcacgctggggctcgctttacgacgcc
ttctacggcaccgacgccatcccgcatgatccgagcgagggcggaaagggctacaacaag
gcgcgcggcgacaaggtgatcgccaaggccaaggcgtttctcgacgcggctgcgccgctc
gccaccggcagccataccgacgtgaccgcctacagcgtgatcgcggggcagctctcggcc
aagctcaagagcggcaacgccacggcgctgaaggatggcgcgcagttcgcgggctaccag
ggttcggcggaagcgcccagcgtgatcctgctcgccaataacggcctgcacatcgaggtg
gtgatcgatcgcagccacgtcatcggcaaggacgatccggccggcgtctccgacatgatc
ctggaggccgcggtctcgaccattctcgacatggaggactcggtcgccgcggtcgatgcc
gaggacaaggtgctggtctatcgcaacacgctcggcctgatgaacggcacgctctcggcc
gatttcgagaagggcggcaagacgctgacccgcgcgctgaacagcgaccgcagctacacc
acgccgtccggcggcacgctgactttgcaagggcgcagcctgctgctgatccgcaattgc
ggacatcacatgttcaccgacgccgtgctcgacgacaagggcgaggaggtgccggaaggc
attctcgacgctgccgtgaccggcctgctggcgatccacgacctcaagggccattccaag
gtcaagaacagccgcaccggctcgatctacatcgtcaagccgaagatgcacggccccgac
gaggtcgcgctcacggtcgaattgttcgcgcgcgtcgagaagctgctcggcctgcccgag
aacagcatgaaggtcggaatcatggacgaggagcgccgcaccacggtgaacctcaaggcc
tgcatccagcaggcttccaagcgcatcgtgttcatcaataccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagcgggcccgatgatccgcaagaacgagatgaag
gcgcagccctggatcaagtcctatgaggattggaacgtcgacatgggcctgacctgcggc
cttccgggccacgcccagatcggcaagggcatgtgggccgcgccggacaagatggcggac
atgctggcgcagaagatcggccatccgcaggcgggcgcgaccaccgcctgggtgccgtca
ccaaccgcggcgacgctgcatgccctgcactatcaccaggtcaacgtgcacgcccgtcag
gccgagctcaccaagggcggcccgcgcgccaagctcggcgacatcctcaccattccggtg
tcgaactcgaactgggcccccgacgacgtccgccaggagatcgacaacaactgccagggc
attctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgccggac
atccacgatgtcggcctgatggaggatcgtgcgaccttgcgcatctccagccagcatctt
gccaactggctgcaccatggcgtcgtcaccaaggaccaggtgatggactcgctgaagcgc
atggccgtggtggtcgacaagcagaatgccggagatccgctctacaagccgatggcgccg
tcattcgatggcgtcgcgttcaaggcggcgtgcgatctggtgttcgaaggtcgcacccag
cccaacggctacaccgagtacatcctgaccgcgcggcgccgtgaggcaaaagcgcaggcc
tga

DBGET integrated database retrieval system