KEGG   Bradyrhizobium sp. BTAi1: BBta_7056Help
Entry
BBta_7056         CDS       T00528                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BBta_7056
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBta_7056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7394106..7394654)
Genome map
AA seq 182 aa AA seqDB search
MDSFELNKILGAVLAACLVVLVTSFSAGALFAPKMPEKPGFEIAVKESEGAAKGGAAPAA
AEPIEKLLQTASVEKGAAAAKKCAACHTFAKGEKNGVGPNLWGVVGDKIGEGRGFNWSQA
IKAKGGTWTIDALNQFIANPKGYIPGTAMGFAGIQKDSERADVLAYLNSLSDNPAPLPTA
AK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggactccttcgaactgaacaaaatcctcggcgccgtcctggccgcctgtctggtcgtg
ctggtgacgagcttcagtgccggcgcgctgttcgcgccgaaaatgcccgagaagccgggt
ttcgagatcgccgtcaaggagagcgagggcgccgccaagggtggcgctgcgccggccgcc
gccgagccgatcgagaagctgctgcagaccgcttcggtcgagaagggcgccgccgccgcc
aagaagtgcgcggcctgccataccttcgcgaagggcgagaagaacggcgtcgggccgaac
ctctggggcgtcgtcggcgacaagatcggcgaaggccgcggcttcaactggtcgcaggcg
atcaaggccaagggcggcacctggacgatcgacgcgctgaaccagttcatcgccaacccc
aagggctacatcccgggcaccgcgatgggcttcgccggcatccagaaggactcggagcgg
gctgacgtgctggcctatctgaactcgctgtcggacaatccggcgccgctgccgaccgcg
gccaagtga

DBGET integrated database retrieval system