KEGG   Bradyrhizobium sp. BTAi1: BBta_7344Help
Entry
BBta_7344         CDS       T00528                                 

Gene name
recR
Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BBta_7344 (recR)
DNA repair and recombination proteins [BR:bbt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BBta_7344 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BBta_7344 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(7709114..7709713)
Genome map
AA seq 199 aa AA seqDB search
MAVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKREALMVPLASAMQVAIERIQVCKT
CGNIDTQSPCTVCTDPRRDPAMIVVVADVADLWALERAKASNGRYHVLGGTLSPLDGVGP
QDLTIDALVQRAHAPEVSEIILALNATVDGQTTAHYITDLLQEANVKVTRLAHGVPVGGE
LDYLDEGTLSAAMRQRTLF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgccggtcctgaaatcgagcgtctgatccagctgcttgcgcgcctgcccggg
ctcgggccgcgctcggcacggcgtgccgcgctgcatctgatcaagaagcgcgaggcgctg
atggtgccgctcgcctcggcgatgcaggtcgcgatcgagcgcatccaggtctgcaagacc
tgcggcaacatcgacacccaaagtccgtgcacggtgtgcaccgacccgcggcgtgatccc
gcgatgatcgtggtcgtcgctgatgtcgccgatctctgggcgctggagcgtgcgaaggca
agcaacggccgctatcacgtgctcggcggcactttgtcgccgctcgacggtgtcggcccg
caggatctcaccatcgacgcgctggtgcagcgcgcgcatgcgccggaggtgtccgagatc
atcctcgcactgaacgcgacggtcgatggccagaccaccgcgcactacatcaccgacctc
ctgcaggaggcgaacgtcaaggtcacgcgactggcgcatggcgtgccggtcggcggcgag
ctcgattatctcgacgaaggcacgctctcggccgcgatgcggcagcgcaccctgttctaa

DBGET integrated database retrieval system