KEGG   Bradyrhizobium sp. BTAi1: BBta_7760Help
Entry
BBta_7760         CDS       T00528                                 

Definition
Acetyl-CoA synthetase (EC:6.2.1.13)
Orthology
K09181  
hypothetical protein
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(8147939..8150650)
Genome map
AA seq 903 aa AA seqDB search
MSTYRLEKLLNPGSIAVVGGSLREKSLGRAVLRNLRTAGFTGSISLVNSRYPAIDGNISV
KALADLTSPPDLVVICVPPVSVPSVVAEAGARGAAAAIIITAGLGHGSGSLADVCERSAR
AAGLRLVGPNCLGVLAPGARLNASFASRMPLAGDLAVVSQSGAIAAGMVEWASQRTVGFS
AIISIGDQLDVDFGDLLDFFAFDRATRAVLLYVESVKDARKFMSAARAAARTKPVVVVKS
GRHAAAAKAAATHTGAMAGSDAVYDAAFRRAGLLRVLDLGELFDAAETLSRVKTVAGKRL
AILTNGGGAGVLAIDRLLDFGGVAAELSEEVRARLDTVLPITWSKLNPVDIIGDADAVRY
ETALEILASDSANDAVLVINVPTALASATDTANAIVRFNEKQQKKDGLPKPLFSVWLGAG
RDVSEIFDRARIPHYPTETDAVRGFMHLVHHSEAATALMEAPPSLPETFAPDTSTARRVV
MAAISETRDWLDPLEVVELFNAYAIPIAPTAFAATPEQAEKACAPFLTDGNKVAVKIVSR
DITHKSDVGGVRLNLSSPMEVRRATEEMFVKVKAARPQARITGVSLHPMIVRPAARELIA
GIADDETFGPVVLFGQGGTAVEAINDKALALPPLDLKLAHELIERTHVSRLLRAHRNVPQ
VNVNEVALVLVKLAQLVADVPEIRELDINPLLADDTGVLALDGRVVVGKVVPKVTGRGHP
RLTIRPYPKEWERHVSIDEDWRLFIRPVRPEDEHLVRAFFERVSPEDLRLRFFTPVKEFS
RIFIARLTQLDYARAIAFIAIDEASHEMIGGVRLHADADYDVGEYAILLRSDVKERGLGR
TLMNLIIEYAQAEGIKNIKGQILREDGAMLRMCRELGFNIVDDSEDPGICTAVLSLSDKK
KLP
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatacaggcttgaaaagctcttgaatcctgggtcgatcgcggttgtcggagga
agcctgcgagaaaaatcgcttggacgagcggtacttcgaaatttacgcacagctggcttt
accgggtcaatcagcctggtcaattcacgatatcctgcaatcgatggcaacatatctgta
aaggcgcttgccgatctcacctcaccgccagatttggttgtcatttgcgttcctccggtc
agtgtaccgtcggtcgttgcggaagcaggagcccgaggtgctgccgcagctatcattatc
accgcgggactcggtcatggctccggctcgcttgcggacgtatgcgagcgctcggcccgc
gcggcgggactaaggctggtcggcccgaattgccttggcgtgctggctcccggagcgaga
ctcaatgcaagttttgcatcgcgcatgccgctggccggagaccttgcagtcgtctcgcag
tccggcgccattgcggctggtatggtcgagtgggcttctcagcgcacagtcggcttctcc
gcgatcatctctatcggcgatcaactcgacgtcgactttggagacttgcttgattttttt
gctttcgatcgtgcaacgcgtgccgttctcctttatgtggagtccgtcaaggatgcgcgc
aaattcatgtcggccgcacgcgcagcagctcgtaccaagcctgtggttgttgtgaagtcc
ggacgtcatgctgcggccgcaaaagcagcggcgacgcacaccggcgctatggccggctcg
gacgctgtatatgatgctgctttccggcgagcgggtctgttacgtgtgcttgaccttggt
gaattgttcgatgcggcagagacattgagtcgagtcaagacagtcgctggaaagcggctt
gcgatcttaaccaatggtggcggcgcaggtgtgttggcaatcgatcgcctgctggatttc
ggcggtgttgcagccgaactctcggaggaggtccgcgcgcgtcttgatacagtcctgccc
attacttggtcgaagttaaatcctgttgatatcatcggcgatgccgatgctgttcgttac
gaaacggcattggaaatcctcgcctccgactccgcaaatgatgccgttctggtcataaat
gtgccgacggcgcttgcctcggcaacggacactgccaatgcgattgtgagattcaacgaa
aagcaacagaaaaaagacggtctgccgaaaccactcttttcggtctggcttggcgctggc
agagacgtatccgaaatctttgaccgcgcaaggataccacactacccgaccgaaaccgac
gccgttcgtgggttcatgcacctggtccaccatagcgaggctgcaacggcgctcatggag
gctccgccaagtcttccggagactttcgccccggacacgtcgaccgctcgccgcgtcgtc
atggccgccatttccgaaacacgggattggctcgatccgctggaggttgtcgagctattc
aatgcctatgctattccaatcgctccgacggcattcgccgctacgcctgaacaggccgaa
aaagcctgcgcccccttcctgactgatggtaataaagtcgcggtcaagatcgtttctcgc
gatattacgcacaaatcggatgtgggcggggtgcggctcaacctttctagcccaatggag
gtgcgaagagcaaccgaagaaatgtttgtgaaagtcaaagccgcaaggccacaagcacga
ataaccggggtcagccttcatcccatgatcgtgcgaccggccgcccgcgaactcatagcc
ggaatcgcagatgatgagaccttcggtcccgtagttctatttggccaaggaggcactgcg
gttgaggcgatcaacgacaaagcgttggcgctcccaccgctggatttaaagctggcgcat
gaactcattgaacgaacgcacgtttcacgtctgttgcgcgcccatcgcaatgttccacaa
gtcaacgtaaacgaggtcgccctggtattggtcaagctcgcgcagcttgtcgcggacgtg
cccgaaatccgtgagctcgatatcaaccccctgctcgcggacgacacaggggtcctcgct
cttgatggccgagtagttgtggggaaagtagttccgaaagttaccgggcgtggccaccct
cgtctgactatccggccatatccgaaagagtgggaaaggcatgtttctattgatgaagat
tggcgtctgttcattcgcccggtccgcccagaggatgaacatctggttcgcgcgttcttc
gagcgcgtatcaccagaagatttacggctgcgtttttttactccagtcaaagagtttagt
cgtatcttcatcgcgcgcctcacccaactcgactacgcgagagcgatcgcattcattgcc
atcgacgaagccagccacgaaatgattggcggcgttcgccttcatgccgatgcagactat
gatgttggagaatatgccattcttcttcgctccgacgtcaaggaacgcgggcttggcagg
acgcttatgaacttgattatcgaatatgctcaagccgagggtatcaaaaacatcaagggc
cagatcctacgtgaagatggggcgatgctacgtatgtgccgagagcttggctttaacatc
gtcgatgattccgaggatccgggaatttgcaccgccgtgctatcgctttcggataagaaa
aagcttccgtga

DBGET integrated database retrieval system