KEGG   Bradyrhizobium sp. BTAi1: BBta_7825Help
Entry
BBta_7825         CDS       T00528                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BBta_7825
Enzymes [BR:bbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BBta_7825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(8208169..8209101)
Genome map
AA seq 310 aa AA seqDB search
MTIMSKSGVAVLGIFVVDLAFRAGNMPAIGETIAGSGFAMGPGGKGSNQAVAAARAGAEV
TFVSRIGADAFGELAVKTWEAEGIRPRVSRTADAPTGAAFIYVHETRGDNAIIVVSGAAD
GLGAADVDAAAEAIRSSRVFVTQLEQPVAAAQRGLEIARAAGSITVFNPAPATAFDDRLF
ALCDYVVPNETEAEALTGIAVSDLAGARRAGDALLAKGAGTALITLGERGALFHGRDHSL
HVPPFAAGKVVETAGAGDAFVGGFAAALAGGADPLEAARFGSATAGISVTRAGTAPAMPR
RAEIEALLQK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcatgagcaagagtggcgtcgccgttctcggcatcttcgtcgtcgatctggcc
ttccgggccggcaacatgcctgcgatcggcgaaaccatcgcaggctcgggatttgccatg
ggaccgggcggcaagggatcgaaccaggccgtcgcggccgcgcgcgcgggcgcggaggtg
accttcgtctcgcggatcggcgccgatgccttcggtgagcttgccgtcaagacgtgggaa
gccgagggcattcggccgcgcgtgtccaggacggcggacgcgccgacgggcgccgccttc
atctatgtccacgagacgcgcggcgacaacgccatcatcgtggtgagcggagcggccgat
ggtctcggcgcggcggatgtcgatgccgcggcggaggcgatccgcagcagccgcgtgttc
gtgacccagctcgaacagccggtcgccgcagcgcagcgcgggctcgagatcgcgcgggct
gcgggcagcatcacggtgttcaacccggctccggcgaccgcgttcgacgaccgcctgttt
gcattgtgtgactacgttgttcccaacgagaccgaagccgaggcgctgacggggatcgcg
gtgagcgatcttgccggcgcgcgccgggcgggagacgcgctgctggccaagggggccggg
accgcgctgatcaccttgggtgagcgtggcgcactgttccatgggcgagatcattcgttg
cacgtgccgccatttgccgccggtaaggtggtcgagacggccggtgcaggcgatgccttc
gtcggcggctttgcggccgcgctggcgggcggcgccgatccgctggaggccgcgcgcttc
ggttcggcgacggccggaatttccgtgacgcgtgccgggactgcgcctgccatgccgcgg
cgggcggagatcgaggccttgttgcagaagtga

DBGET integrated database retrieval system