KEGG   Bradyrhizobium sp. BTAi1: BBta_p0098Help
Entry
BBta_p0098        CDS       T00528                                 

Definition
(GenBank) putative Glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00500  Starch and sucrose metabolism
bbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBta_p0098
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BBta_p0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM53
Motif
Other DBs
NCBI-ProteinID: ABQ39780
RhizoBase: BBta_p0098
UniProt: A5EUD6
Position
pBBta01:74244..76751
Genome map
AA seq 835 aa AA seqDB search
MTARCSPPSPGRPVWATMKTIHHDNHGRLVRTKTAPAVERPRANHWEPDPNLDAPGAPGI
PPTWTSSSKDVVGSSLGPARLWFTVGYGIVNEVYWPRVDIPQIRDLGFLVADGKGFWAEV
KRLGKYELRAVAEGVSAYEVVHSHSRFSLRLRICPDPRRDVLAIECRLETDDPSLRLYAL
LAPHLGATGYGNRAIIAEQRGRRFLAAARSPFALALAAVDEYQQDAIIRASAGYVGASDG
WQDFARTGEMTWNYPAAGPGNVALMAELPQNSVLALGFATTPAAAATLAVSSLMQPFDRL
LKAQISDWTSWHRSCGECCANPVELARPLRDQFVTSTTVLRTHLDKTYPGAMVASLSIPW
GDSGNERGGYHLVWPRDLVECASALLAFGGEAEARDTLRYLIATQNVEGHWQQNQWLGGE
PYWRGVQLDEAAYPVLLAALLADRDAVDGIEPQDMVRRALGCIARIGPSTDQDRWEENSG
LNAFTLATCIAALVAGSELLDDRARHWATQLADFWNARLDTWLVAPDSDWTRQLNVRGHY
VRTAPGSVLSRRSQALNELVAIRNRADGASLQASAQISTDFLRLVRFGLRHPQDPLILDS
LKVVDHLLRVETPSGVAWRRYNGDGYGEYDDGRPYDGAGKGRPWPLLAGERGHYELCAGQ
DSLPMLETMVASASPGGMIPEQIWDGSSVPQRRLEPGRPTGSAMPLAWAHAEFIKLAVSR
HLGRPADRPEAVWRRYGGQRRTADRTFWWPHAQIATVARGSRLIVAIASAGTVHWGIDGW
NGVNDVEAEDTGLDFFAAELDTSSLRDGQWVDFTIRWRDGNWAGIDYRVEIKADP
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaaggtgttctccaccctccccgggcaggccagtgtgggccacgatgaaaacc
atccaccacgataatcacggacgtctggtgagaaccaaaacggccccggcggtggaaaga
ccgcgggccaatcattgggagccagatccaaatcttgacgctccgggagcgccgggcatc
ccgccgacttggacaagcagcagcaaggatgtcgtcggatcgtcgcttggacctgcgcgc
ctgtggttcacggtcggttacgggatcgtcaacgaggtctactggcctcgggtcgatatt
ccgcaaattcgcgatctcggctttttggttgccgacgggaagggattttgggcggaggtc
aagcgacttggcaaatacgaacttcgagcggtcgccgagggcgtttcggcctacgaagtc
gtacactcacattcgcgcttctcgttgcgtttgcggatctgccccgacccgcgacgggat
gtgctcgcgatcgaatgtcgccttgagactgacgatccgtcgttgcggctatacgcgttg
ctcgcacctcacctcggggcgaccgggtatggcaatcgcgccatcattgccgaacagcgc
ggccggcgattcttggccgcggcacgctcgccgtttgcgctggcgctcgccgctgtcgac
gaataccagcaggatgccattatccgggcaagtgccggatacgtgggcgccagtgacgga
tggcaggatttcgctcggacgggggagatgacttggaattatcctgccgcaggcccgggg
aacgtcgcgctgatggcggaattgccgcaaaacagcgtattggccctgggctttgccacc
acccctgcagccgcggcgacacttgctgtttcatcgttgatgcaaccatttgaccgactg
cttaaggcccagatctcggattggaccagttggcaccgcagttgcggggagtgctgcgca
aatccggtcgaattggcccggccgctgcgggaccaatttgtcacgtccacgaccgtgctg
cgcacgcatctggacaaaacctatcccggtgccatggtggcgagcctcagcattccctgg
ggcgacagcgggaacgagcgaggtggctatcatctggtctggccacgcgatctcgtcgaa
tgcgcctccgccttgttggccttcggcggagaagctgaagcacgcgacacgctgcgttat
ctaattgccacacagaacgttgaaggacactggcaacaaaaccagtggctggggggcgaa
ccctattggcgcggtgtccagctggacgaagcggcctatccggtgcttctcgccgcactg
ttggctgaccgggatgcggtcgacggcatcgagccgcaggacatggtccggcgtgcgctg
ggatgcatcgcgcgtattggtccctcgaccgatcaagaccgttgggaagaaaacagcggt
ctgaacgcattcaccttggctacctgtatcgcggccctggtcgcgggcagcgaattgctc
gacgacagggcccggcactgggccacgcaactcgccgatttctggaatgcccgtctcgat
acctggctggttgcccccgacagcgattggacgaggcaattgaacgtgcgcggccactat
gttcgcaccgcgccaggctccgtcctgtccagacgaagccaagcactgaacgagttggtc
gcgatccgcaaccgcgccgacggagcaagcctgcaggcgagcgcgcagatcagcaccgat
ttcctgcgcttggttcgcttcgggctacgccacccgcaggatcccctaatcctcgacagc
ctgaaagtggtagatcatctgcttagggttgagaccccatccggcgtagcttggcgtcgc
tacaatggcgatggctacggcgagtacgatgatggccggccttacgatggggctggcaaa
ggtcggccatggccgctccttgcgggcgaaagaggtcattacgagctctgcgccggccag
gattccctgccaatgctcgaaaccatggtggcttcggccagtccgggtggaatgatcccg
gagcaaatctgggacggatcctcggttccgcagcggcggctcgagccaggtcgccccacc
ggctcggccatgccgctggcctgggcccacgcggagttcatcaagctcgcggtctcgcgg
cacttgggtcggcctgccgacagaccagaagcggtttggcggcgctatggtggtcagcgc
cgaacggccgatcgcacgttctggtggccgcatgcgcaaattgcgacggtggcccgcggc
agccgcctcatcgtcgccatcgccagcgctggtacagtgcattgggggatcgatggctgg
aacggtgtgaacgacgtcgaggctgaagacaccggtcttgatttctttgctgctgaactc
gacacctcatccctgcgagatgggcaatgggtggacttcactattcgctggcgcgacggc
aactgggcaggcatcgattaccgcgtcgaaatcaaggcagacccatag

DBGET integrated database retrieval system