KEGG   Borrelia burgdorferi B31: BB_0241Help
Entry
BB_0241           CDS       T00012                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bbu  Borrelia burgdorferi B31
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BB_0241 (glpK)
Enzymes [BR:bbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BB_0241 (glpK)
Exosome [BR:bbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BB_0241 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246597..248102
Genome map
AA seq 501 aa AA seqDB search
MKYILSIDQGTTSSRAMVFDKNANIKGFAQKEFTQIYPQPSWVEHDPTEIWGSQLGVITE
AMANARILPNEIDAIGITNQRETTVIWEKNTGKPIYNAIVWQDRRTAKICDQLKKEGKDK
IILEKTGLVLDSYFSGTKIMWILDNVEGARQRAENGELCFGTIDTWILWNLTQKKEHATD
YSNASRTLLLNIKTLEWDDELLSILNVPRAILPELKESSTIYGKTDKALFGAEIPIAGIA
GDQFAATFGQACLKKGMAKNTYGTGCFLTVNIGKEPIISHDKLLTSIAWGRKKSVTYVLE
GSVFIGGAVIQWLRDGLEFFRKSSDAEALASSVSDNGGVYFVPAFVGLGAPHWDSYARGT
IIGITRGSTKAHITRAALESIAFQSFDILNTMKKSIPNFEIQELRVDGGASQNNLLMQFQ
ADLLECKVVRPKITETTALGAAYLAGLATGYWQSAEEIVSLWQVDKIFEPSMPKNQKEKL
LENWNKAVGKAKSWIQNSHSS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacattttatctattgatcaaggtactactagctcgagagcaatggtatttgat
aaaaatgcaaacataaaggggtttgctcaaaaagaatttactcaaatttatccacaacca
agttgggtggaacatgatcctacagaaatatggggctcacaacttggagttataacagaa
gctatggcaaatgcaagaattttgcccaatgaaattgacgctattggaataactaatcaa
agagaaactacggttatatgggaaaaaaatacaggaaagcccatctacaatgcaatagta
tggcaagacagaagaactgcaaaaatttgtgaccaattaaaaaaagaaggaaaagataaa
attattttggaaaaaacaggcttggtgctagattcttattttagtggaacaaaaataatg
tggatattggataatgtagaaggtgccagacaaagagccgaaaatggcgaattatgcttt
ggaacaatagatacatggatattgtggaacctgactcaaaaaaaagaacatgcaaccgat
tactctaatgcttcaagaacattattattaaacattaaaacattagagtgggatgatgaa
cttttaagcatattaaatgttccaagggcaattttgcctgaacttaaagaaagttctaca
atatacggcaaaacagacaaagcactatttggagcagaaattcctattgcaggaattgct
ggggatcaatttgcagcaacatttggacaagcctgccttaaaaagggtatggccaaaaac
acttatggaactggctgcttcttaacggttaatataggaaaagaaccaatcattagccac
gacaagcttttaacttcaattgcatggggaagaaaaaaatctgtaacctacgttcttgaa
ggaagtgtttttattggaggagctgtaatccagtggttaagagacggtcttgaatttttc
agaaaaagctcagatgcagaagcgttggcaagctctgtctcagataatggtggagtttat
tttgtgccagcatttgttgggcttggtgcacctcactgggattcttatgcaagaggaaca
atcatcggaataacaagaggctcaacaaaagctcacattacaagagctgctcttgagagc
atcgcatttcaaagcttcgatatactaaataccatgaaaaaatccattcccaactttgaa
attcaagaattaagagtagacgggggagcaagtcaaaacaatctattaatgcaatttcaa
gctgatcttttagaatgtaaagttgtaagaccaaaaataacagaaacaaccgctcttggc
gctgcttatcttgcaggacttgcaacgggttattggcaaagcgccgaagaaatcgtaagc
ctttggcaagtagacaagatatttgaaccttcaatgccaaaaaatcaaaaagaaaagctt
cttgagaattggaacaaagcggttggaaaagcaaaatcctggatacagaattctcatagt
tcataa

DBGET integrated database retrieval system