KEGG   Borrelia burgdorferi B31: BB_0383Help
Entry
BB_0383           CDS       T00012                                 

Gene name
bmpA
Definition
hypothetical protein
Orthology
K07335  
basic membrane protein A and related proteins
Organism
bbu  Borrelia burgdorferi B31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(393044..394063)
Genome map
AA seq 339 aa AA seqDB search
MNKILLLILLESIVFLSCSGKGSLGSEIPKVSLIIDGTFDDKSFNESALNGVKKVKEEFK
IELVLKESSSNSYLSDLEGLKDAGSDLIWLIGYRFSDVAKVAALQNPDMKYAIIDPIYSN
DPIPANLVGMTFRAQEGAFLTGYIAAKLSKTGKIGFLGGIEGEIVDAFRYGYEAGAKYAN
KDIKISTQYIGSFADLEAGRSVATRMYSDEIDIIHHAAGLGGIGAIEVAKELGSGHYIIG
VDEDQAYLAPDNVITSTTKDVGRALNIFTSNHLKTNTFEGGKLINYGLKEGVVGFVRNPK
MISFELEKEIDNLSSKIINKEIIVPSNKESYEKFLKEFI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatattgttgttgattttgcttgagagtattgtttttttatcttgtagtggt
aaaggtagtcttgggagcgaaattcctaaggtatctttaataattgatggaacttttgat
gataaatcttttaatgagagtgctttaaatggcgtaaaaaaagttaaagaagaatttaaa
attgagcttgttttaaaagaatcctcatcaaattcttatttatctgatcttgaagggctt
aaggatgcgggctcagatttaatttggcttattgggtatagatttagcgatgtggccaag
gttgcggctcttcaaaatcccgatatgaaatatgcaattattgatcctatttattctaac
gatcctattcctgcaaatttggtgggcatgacctttagagctcaagagggtgcattttta
acgggttatattgctgcaaaactttctaaaacaggtaaaattggatttttagggggaata
gaaggcgagatagtagatgcttttaggtatgggtatgaagctggtgctaagtatgctaat
aaagatataaagatatctactcagtatattggtagttttgctgaccttgaagctggtaga
agcgttgcaactaggatgtattctgatgagatagacattattcatcatgctgcaggcctt
ggaggaattggggctattgaggttgcaaaagaacttggttctgggcattacattattgga
gttgatgaagatcaagcatatcttgctcctgacaatgtaataacatctacaactaaagat
gttggtagagctttaaatatttttacatctaaccatttaaaaactaatactttcgaaggt
ggcaaattaataaattatggccttaaagaaggagttgtggggtttgtaagaaatcctaaa
atgatttcctttgaacttgaaaaagaaattgacaatctttctagcaaaataatcaacaaa
gaaattattgttccatctaataaagaaagttatgagaagtttcttaaagaatttatttaa

DBGET integrated database retrieval system