KEGG   Borrelia burgdorferi B31: BB_0415Help
Entry
BB_0415           CDS       T00012                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bbu  Borrelia burgdorferi B31
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bbu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BB_0415
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BB_0415
Enzymes [BR:bbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BB_0415
Two-component system [BR:bbu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BB_0415
Bacterial motility proteins [BR:bbu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BB_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425584..426711
Genome map
AA seq 375 aa AA seqDB search
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNSKFATNKLKKHKPEVILMNLEE
NNIKDILFLEEKNSLNKTIPIVVTSSNQNLINIAASKGADDLILVSKNKKSHEIKKEQII
NSLLAYGSISIKNKIACNKDMKTKNYERANFILNHKNDISSLNQLEEHAKEKTLNEKEIK
KLKLRKFDIIAIGVSAGGPVALKSILPEIPESFPPIIIVQHMPKGFTEEFAKNLNNLCKI
SVKETTNNEILKQGYAYISSGGYHTKIKKIDGNYQIKTLDGKHINGHKPSIGVLFQSIAE
IAKDKAIAIIMTGMGNDGSREIGDIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LSHMVKLLKAILINS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacaaaaatttctgtacttatcatagaatactttgctgtaaagagaaaacttata
tcagaccttatcaattcatctccaaaactccaagtcattgcaactgcttctaacagcaaa
tttgcaacaaataaacttaaaaaacataaacccgaagtaatattaatgaatttagaagag
aacaatattaaagatattctatttttggaggaaaaaaacagtttaaacaaaacaatacca
attgtcgtcacatcttcaaatcaaaacctaataaatattgctgcttcaaagggcgccgat
gatcttatattagtatctaaaaacaaaaaatcacatgaaatcaaaaaagaacaaattatt
aattctcttttggcctatggatcgatatctataaaaaataaaattgcctgcaataaggac
atgaaaacaaaaaactacgaaagagctaattttattttaaatcacaaaaatgacatttct
tcattaaatcaacttgaagaacatgcaaaagaaaaaacattaaatgaaaaagaaataaaa
aaacttaaactgagaaaatttgacataatagcaattggagtatcagcgggggggcctgta
gccttgaaatcaatattaccagaaatacctgaaagctttccgccaataataattgttcaa
catatgcctaaaggatttacagaagaatttgccaaaaatcttaataatctatgtaaaata
agcgtaaaagaaaccaccaataacgaaatattaaagcaaggatatgcatacattagctcg
ggcggatatcatacaaaaatcaaaaaaatcgatggtaactatcaaataaaaaccctcgat
ggtaaacatataaatggtcacaaaccatctattggggtattatttcaatctattgcagag
attgcaaaagataaagcaattgccataataatgactggaatgggaaatgatggatcaaga
gaaattggagatataaaaaaagctggaggactaactattgcgcaagataaagaaagttct
atggtttttggaatgccaaaaatagcaataaaggaaaacaatatagactatatagttcca
ctaagccatatggtaaaattattaaaagctatactaattaatagctaa

DBGET integrated database retrieval system