KEGG   Borrelia burgdorferi B31: BB_0629Help
Entry
BB_0629           CDS       T00012                                 

Definition
PTS system fructose-specific transporter subunit IIABC
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
bbu  Borrelia burgdorferi B31
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bbu00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:bbu02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(659644..661515)
Genome map
AA seq 623 aa AA seqDB search
MQNLFSKNLIVLNYNATSKEDVIRKMASMFNENGYLNDMEAFIKEIKKREETNGTGIEEH
IAMPHAKGNFIKKHGIAILRVVGNGFDFNSSDQKLSKLFFMMALPEETPSNAHIKAISYL
SNTFSNNLLRHELMSTNNEDRFLEIILNNDNINESNNLNTKKDFILAVTACPVGIAHTYM
AAESLKKAALELNINIKVETNGSSGTENPITEEEIKKAKGVIIASGKTIDKERFSGKPLI
EVGVKDGIHKAKELIQTILKNEAPIYKKSNTNKTTETLQKQNKKTGIYKHLMNGVSFMLP
FVVSGGIIIAISFMFGIKAFDINDPSYNKIADILMQIGGGSAFALMIPILAGYISFSIAE
RPGLAPGMITGLMMNNGNAGFLGGILAGFISGYVTLTVKKISDKIIPSNLRGINPVLTYP
FLSVIISGILIYGMLSPISVINESITNMLNQLSGTNMAILGALLGGMMAIDMGGPVNKAA
YAFGIAMITAKNYIPHASIMAGGMIPPIGIALATSLFKNRFSKEERESGKVCYFLGACFI
TEGVIPFAAADPLRVIPACILGSSVGGFISALFKVEVIAPHGGIFILPIVVNPLMWITSI
LVGSIITAVLIGILKKEYKNIND
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttattttcaaaaaacttgattgttttaaattacaatgcaactagtaaagaa
gatgtaattagaaaaatggctagcatgttcaatgaaaatggatacttaaatgacatggaa
gcatttataaaagaaattaaaaaaagagaagaaactaacggaacaggcattgaagagcat
atagctatgcctcatgcaaaaggcaatttcattaaaaaacacggaattgctattttaaga
gttgttggcaatggttttgacttcaactcttctgatcaaaagctttcaaaactgtttttc
atgatggccctacccgaagaaactccaagcaatgcacacataaaagctatatcataccta
agtaatacttttagcaacaacctattaagacatgaacttatgagcacaaataatgaagat
agatttttagaaataatattgaataatgacaatataaatgaatctaacaatttaaataca
aaaaaagatttcattcttgccgtaacagcatgtcctgtgggaatagctcacacctatatg
gcagcagaaagccttaaaaaagcagctttagaattaaacataaatataaaagtagaaaca
aatggatctagtggaaccgaaaatccaataacagaagaagaaataaaaaaagcaaaagga
gtcattattgcatctggcaaaactatcgataaagaaagatttagcggaaaacctttaatc
gaagtgggagtaaaagacggcatacacaaagcaaaagagcttatccaaacaattcttaaa
aacgaagcaccaatttacaaaaaaagcaacacaaacaaaaccaccgaaaccctccaaaaa
caaaacaaaaaaacggggatttataaacatctaatgaatggggtctcatttatgcttcca
tttgtagtctcaggaggaataataatagcaatatcattcatgtttggaatcaaagcattt
gacataaacgatccaagctacaataaaatagcagatattctaatgcaaatcggcggtgga
agcgcatttgctttaatgatcccaatacttgctggctatatttcatttagcatagcagaa
agaccaggacttgcacctggaatgattacaggattaatgatgaacaatggaaatgcagga
tttttgggaggcatcttagcaggatttatttcaggctacgttacactaactgtaaaaaaa
atatctgacaaaataattcctagcaatttaagaggaataaatccggtattaacttatcct
tttttatcagttataatttcaggaattttgatatatggaatgcttagtccaatatctgtt
attaatgaatcaataacaaatatgctaaatcaacttagcggtactaatatggcaatactt
ggagctttgcttggaggaatgatggcaatagatatgggagggcctgtaaataaagctgca
tatgcatttggaattgcaatgataactgccaaaaattatattcctcacgcaagcataatg
gcaggaggaatgatacctcccataggaattgctcttgctacaagtttatttaaaaataga
ttctcaaaagaagaaagagaatctggaaaagtttgttattttttgggagcatgctttatt
acagaaggagtaattccatttgcagcagcagatcctttaagggtaatacccgcatgtata
ctaggctcatctgtaggaggatttatttctgcacttttcaaggtagaggttatagcacca
cacggcggaatatttattctaccaatagtagtaaacccattaatgtggataacatctatc
ctggtaggatctattataacagctgttttaataggaatccttaaaaaagaatacaagaat
ataaacgattaa

DBGET integrated database retrieval system