KEGG   Borrelia burgdorferi B31: BB_0658Help
Entry
BB_0658           CDS       T00012                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbu  Borrelia burgdorferi B31
Pathway
bbu00010  Glycolysis / Gluconeogenesis
bbu00260  Glycine, serine and threonine metabolism
bbu00680  Methane metabolism
bbu01100  Metabolic pathways
bbu01110  Biosynthesis of secondary metabolites
bbu01120  Microbial metabolism in diverse environments
bbu01130  Biosynthesis of antibiotics
bbu01200  Carbon metabolism
bbu01230  Biosynthesis of amino acids
Module
bbu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB_0658
  Energy metabolism
   00680 Methane metabolism
    BB_0658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BB_0658
Enzymes [BR:bbu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BB_0658
Membrane trafficking [BR:bbu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BB_0658
Exosome [BR:bbu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BB_0658
  Exosomal proteins of melanoma cells
   BB_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 1195510
NCBI-ProteinID: NP_212792
UniProt: O51602
Structure
PDB: 

Jmol
Position
697586..698332
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggagagagtgagtggaataaagaaaatcttttt
actggttggacagatgttaaactttctgacaagggtatcgatgaggctgttgaggcgggt
ttgcttctcaaacaagaaggctattcttttgatattgcttttagttctttgttgtcaaga
gctaatgacactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgaaaggcactatggagctttgcaaggtttaaataagtcagaa
acagctgcaaaatatggggaagataaggttttaatttggagacgtagttatgatgtgccc
ccaatgtctttggatgagtctgatgatcgtcatcccataaaagatccaagatataaacat
atccccaaaagggaacttccttcaacagagtgccttaaagatactgttgcaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgaaggtaaaaaagttattgttgct
gctcacggtaattctttaagagcgcttgttaaatattttgacaatttaagtgaagaagat
gttttaaagcttaacattcccacaggcattcctttagtttacgaattagataaagattta
aatcccattaaacattactatctaggtgatgagagcaaaattaaaaaggcaatggaatct
gttgctagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system