KEGG   Borrelia burgdorferi B31: BB_0658Help
Entry
BB_0658           CDS       T00012                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbu  Borrelia burgdorferi B31
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB_0658
   01230 Biosynthesis of amino acids
    BB_0658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB_0658
  Energy metabolism
   00680 Methane metabolism
    BB_0658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BB_0658
Enzymes [BR:bbu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BB_0658
Exosome [BR:bbu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BB_0658
  Exosomal proteins of melanoma cells
   BB_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
697586..698332
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKKAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggagagagtgagtggaataaagaaaatcttttt
actggttggacagatgttaaactttctgacaagggtatcgatgaggctgttgaggcgggt
ttgcttctcaaacaagaaggctattcttttgatattgcttttagttctttgttgtcaaga
gctaatgacactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgaaaggcactatggagctttgcaaggtttaaataagtcagaa
acagctgcaaaatatggggaagataaggttttaatttggagacgtagttatgatgtgccc
ccaatgtctttggatgagtctgatgatcgtcatcccataaaagatccaagatataaacat
atccccaaaagggaacttccttcaacagagtgccttaaagatactgttgcaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgaaggtaaaaaagttattgttgct
gctcacggtaattctttaagagcgcttgttaaatattttgacaatttaagtgaagaagat
gttttaaagcttaacattcccacaggcattcctttagtttacgaattagataaagattta
aatcccattaaacattactatctaggtgatgagagcaaaattaaaaaggcaatggaatct
gttgctagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system