KEGG   Borrelia burgdorferi B31: BB_0727Help
Entry
BB_0727           CDS       T00012                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbu  Borrelia burgdorferi B31
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bbu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bbu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bbu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:bbu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765373..766716
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYASEGSSHFVNEKNKIKFSVYRNEDKGDRYED
VLLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFDHFPKKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagcttgggagaatgcaag
caaaacaatcctttgattgatttttatgctagtgagggttcttcccattttgttaatgaa
aaaaataaaatcaagtttagtgtatataggaatgaggataagggagataggtatgaagat
gttcttttagaaaaagctgggcctagagaaaaaatttattttgtgcccaggcatgttaaa
gctgctattactacttgtggtgggctttgtcctggttttaacgatgttattcgctctatt
gtgcgaactttatggaaaatatatggggttcgcaatatttatggagtaaaatttggatat
caagggcttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggtactattcttggttcttcaaggggtggtattaagcctgtg
gaaatagttgatactttagagagaatgaacattaatatgatttttaacattggcggggat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcagttgtgggcattcctaaaaccgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagactgctgtagaacaagctgttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggcattggacttgttaaagttatgggacgggattctggctttatt
gctgctcataccgcactttcttctaatgatgttaatttttgtttaatcccagaacttgat
tttgacatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gaaagcttagaagagattccccatgcagtaatattgatagcagaaggagcaggccaaaaa
tattttgatcattttcctaagaagaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcccagctatattattagaagttcacctgctaatgccagtgattcg
ctttattgtgctaggcttgggtcgaatgctgtgcatgctgcaatggctggtaagacaaaa
atgttgattagtttatggagtacaaaatttgttcatatacctattaagatggcagtaatt
gacagaaataaggttaatccaaatggttctttttggagagatgttctttcaagtacgggg
caaccaattagcatgaagaattaa

DBGET integrated database retrieval system