KEGG   Borrelia burgdorferi B31: BB_0727Help
Entry
BB_0727           CDS       T00012                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbu  Borrelia burgdorferi B31
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB_0727
   01230 Biosynthesis of amino acids
    BB_0727
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB_0727
   00030 Pentose phosphate pathway
    BB_0727
   00051 Fructose and mannose metabolism
    BB_0727
   00052 Galactose metabolism
    BB_0727
  Energy metabolism
   00680 Methane metabolism
    BB_0727
Enzymes [BR:bbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BB_0727
Protein phosphatases and associated proteins [BR:bbu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BB_0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765373..766716
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYASEGSSHFVNEKNKIKFSVYRNEDKGDRYED
VLLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFDHFPKKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMAGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagcttgggagaatgcaag
caaaacaatcctttgattgatttttatgctagtgagggttcttcccattttgttaatgaa
aaaaataaaatcaagtttagtgtatataggaatgaggataagggagataggtatgaagat
gttcttttagaaaaagctgggcctagagaaaaaatttattttgtgcccaggcatgttaaa
gctgctattactacttgtggtgggctttgtcctggttttaacgatgttattcgctctatt
gtgcgaactttatggaaaatatatggggttcgcaatatttatggagtaaaatttggatat
caagggcttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggtactattcttggttcttcaaggggtggtattaagcctgtg
gaaatagttgatactttagagagaatgaacattaatatgatttttaacattggcggggat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcagttgtgggcattcctaaaaccgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagactgctgtagaacaagctgttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggcattggacttgttaaagttatgggacgggattctggctttatt
gctgctcataccgcactttcttctaatgatgttaatttttgtttaatcccagaacttgat
tttgacatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gaaagcttagaagagattccccatgcagtaatattgatagcagaaggagcaggccaaaaa
tattttgatcattttcctaagaagaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcccagctatattattagaagttcacctgctaatgccagtgattcg
ctttattgtgctaggcttgggtcgaatgctgtgcatgctgcaatggctggtaagacaaaa
atgttgattagtttatggagtacaaaatttgttcatatacctattaagatggcagtaatt
gacagaaataaggttaatccaaatggttctttttggagagatgttctttcaagtacgggg
caaccaattagcatgaagaattaa

DBGET integrated database retrieval system