KEGG   Borrelia burgdorferi B31: BB_A15Help
Entry
BB_A15            CDS       T00012                                 

Gene name
ospA
Definition
outer surface protein A (OspA)
Organism
bbu  Borrelia burgdorferi B31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
lp54:9457..10278
Genome map
AA seq 273 aa AA seqDB search
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDK
LELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKS
STEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVV
KEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKE
NTITVQQYDSNGTKLEGSAVEITKLDEIKNALK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttattgggaataggtctaatattagccttaatagcatgtaagcaaaat
gttagcagccttgacgagaaaaacagcgtttcagtagatttgcctggtgaaatgaaagtt
cttgtaagcaaagaaaaaaacaaagacggcaagtacgatctaattgcaacagtagacaag
cttgagcttaaaggaacttctgataaaaacaatggatctggagtacttgaaggcgtaaaa
gctgacaaaagtaaagtaaaattaacaatttctgacgatctaggtcaaaccacacttgaa
gttttcaaagaagatggcaaaacactagtatcaaaaaaagtaacttccaaagacaagtca
tcaacagaagaaaaattcaatgaaaaaggtgaagtatctgaaaaaataataacaagagca
gacggaaccagacttgaatacacaggaattaaaagcgatggatctggaaaagctaaagag
gttttaaaaggctatgttcttgaaggaactctaactgctgaaaaaacaacattggtggtt
aaagaaggaactgttactttaagcaaaaatatttcaaaatctggggaagtttcagttgaa
cttaatgacactgacagtagtgctgctactaaaaaaactgcagcttggaattcaggcact
tcaactttaacaattactgtaaacagtaaaaaaactaaagaccttgtgtttacaaaagaa
aacacaattacagtacaacaatacgactcaaatggcaccaaattagaggggtcagcagtt
gaaattacaaaacttgatgaaattaaaaacgctttaaaataa

DBGET integrated database retrieval system