KEGG   Borrelia burgdorferi B31: BB_A16Help
Entry
BB_A16            CDS       T00012                                 

Gene name
ospB
Definition
outer surface protein B (OspB)
Organism
bbu  Borrelia burgdorferi B31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
lp54:10288..11178
Genome map
AA seq 296 aa AA seqDB search
MRLLIGFALALALIGCAQKGAESIGSQKENDLNLEDSSKKSHQNAKQDLPAVTEDSVSLF
NGNKIFVSKEKNSSGKYDLRATIDQVELKGTSDKNNGSGTLEGSKPDKSKVKLTVSADLN
TVTLEAFDASNQKISSKVTKKQGSITEETLKANKLDSKKLTRSNGTTLEYSQITDADNAT
KAVETLKNSIKLEGSLVGGKTTVEIKEGTVTLKREIEKDGKVKVFLNDTAGSNKKTGKWE
DSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEGSASEIKNLSELKNALK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagattattaataggatttgctttagcgttagctttaataggatgtgcacaaaaaggt
gctgagtcaattggttctcaaaaagaaaatgatctaaaccttgaagactctagtaaaaaa
tcacatcaaaacgctaaacaagaccttcctgcggtgacagaagactcagtgtctttgttt
aatggtaataaaatttttgtaagcaaagaaaaaaatagctccggcaaatatgatttaaga
gcaacaattgatcaggttgaacttaaaggaacttccgataaaaacaatggttctggaacc
cttgaaggttcaaagcctgacaagagtaaagtaaaattaacagtttctgctgatttaaac
acagtaaccttagaagcatttgatgccagcaaccaaaaaatttcaagtaaagttactaaa
aaacaggggtcaataacagaggaaactctcaaagctaataaattagactcaaagaaatta
acaagatcaaacggaactacacttgaatactcacaaataacagatgctgacaatgctaca
aaagcagtagaaactctaaaaaatagcattaagcttgaaggaagtcttgtaggcggaaaa
acaacagtggaaattaaagaaggtactgttactctaaaaagagaaattgaaaaagatgga
aaagtaaaagtctttttgaatgacactgcaggttctaacaaaaaaacaggtaaatgggaa
gacagtactagcactttaacaattagtgctgacagcaaaaaaactaaagatttggtgttc
ttaacagatggtacaattacagtacaacaatacaacacagctggaaccagcctagaagga
tcagcaagtgaaattaaaaatctttcagagcttaaaaacgctttaaaataa

DBGET integrated database retrieval system