KEGG   Borrelia burgdorferi B31: BB_A25Help
Entry
BB_A25            CDS       T00012                                 

Gene name
dbpB
Definition
decorin-binding protein B
Organism
bbu  Borrelia burgdorferi B31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
lp54:complement(16696..17259)
Genome map
AA seq 187 aa AA seqDB search
MKIGKLNSIVIALFFKLLVACSIGLVERTNAALESSSKDLKNKILKIKKEATGKGVLFEA
FTGLKTGSKVTSGGLALREAKVQAIVETGKFLKIIEEEALKLKETGNSGQFLAMFDLMLE
VVESLEDVGIIGLKARVLEESKNNPINTAERLLAAKAQIENQLKVVKEKQNIENGGEKKN
NKSKKKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaagctaaattcaatagttatagccttgttttttaaactattggtcgca
tgtagtattggattagtagaaagaacaaatgcagctcttgaatcgtcctctaaggattta
aaaaacaaaattttaaaaataaaaaaagaagccacgggaaaaggtgtactttttgaagct
tttacaggtcttaaaaccggttccaaggtaacaagtggtggactagccttaagagaagca
aaagtacaagccattgttgaaacaggaaagttccttaagataatagaagaagaagcttta
aagcttaaagaaactggaaacagtggtcaattcttggctatgtttgacttaatgcttgag
gttgtagaatcgctagaagacgttggaataataggcttaaaagcccgtgttttagaggaa
tctaaaaataatcctataaacacagctgaaagattgcttgcggctaaagctcaaatagaa
aatcaacttaaagtggttaaggaaaaacaaaatattgaaaatggtggagagaaaaaaaat
aataaaagcaaaaaaaagaaataa

DBGET integrated database retrieval system