KEGG   Borrelia burgdorferi B31: BB_A60Help
Entry
BB_A60            CDS       T00012                                 

Definition
surface lipoprotein P27
Organism
bbu  Borrelia burgdorferi B31
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
lp54:complement(40212..41045)
Genome map
AA seq 277 aa AA seqDB search
MSKKVILILLEILILSCDLSINKEQKTKEKTSEKQESEKQNIEKQEPEKQKQNAAKIIPT
VSIQTVEIRESNQIPKSIEKYYKQAYPIQTFTLDFSITREKEFLKPEDKILPTQGKVESL
SILINKKLLDFKAPENPKSSTLKNFKEIKNIENFFQNQDLLFVLTLKDKNNNNTINIMLN
PPNDIQKPKDYILKDLKDTIKKGTGEKYLNPIYRFQIKNKKDYHSIDYNKVTISEKTIEL
DLLPHEQVFQMNKNFTKILDTITDLNNLKLVIQKELV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaagtaattttaatattactagaaattttgatcttgtcttgtgatttatct
ataaataaagaacaaaaaaccaaagaaaaaacatctgaaaagcaagaatctgaaaaacaa
aatattgaaaaacaagagcctgaaaaacagaaacaaaatgcagcaaaaataatccctacg
gtatcaattcaaacggtagaaataagggaatcaaatcaaattccaaaaagcattgagaag
tactacaagcaagcttatccgattcaaacattcactcttgattttagcatcacaagagaa
aaggaatttctaaaaccagaagataaaatcttgcccacacaggggaaagtggagtctttg
agcatcttaataaataaaaaattgttagactttaaagccccagaaaatccaaaaagctca
actttaaaaaatttcaaagaaattaaaaatattgagaatttcttccaaaatcaagactta
ttatttgtcttaacccttaaagataaaaataacaacaacactattaacatcatgctcaat
cccccaaacgacatccaaaaacccaaagattatattttaaaagaccttaaagacacaatt
aaaaagggtactggtgagaaatacttaaatcctatctatagatttcaaataaaaaacaaa
aaagattatcattcaatagattacaacaaagtgactattagcgaaaaaacaatagaattg
gacctactgcctcacgaacaagtctttcaaatgaataaaaatttcactaaaattttagac
acaataacagacttaaataatctaaaattagtaattcaaaaagaattagtgtaa

DBGET integrated database retrieval system