KEGG   Borrelia burgdorferi B31: BB_A68Help
Entry
BB_A68            CDS       T00012                                 

Gene name
cspA
Definition
(RefSeq) complement regulator-acquiring surface protein 1
Organism
bbu  Borrelia burgdorferi B31
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Borrelia_lipo_1 DUF1993 BLUF DUF5363 DUF4208
Motif
Other DBs
NCBI-GeneID: 1194383
NCBI-ProteinID: NP_045741
UniProt: O50957
Structure
PDB: 

Jmol
Position
lp54:complement(46473..47228)
Genome map
AA seq 251 aa AA seqDB search
MKKAKLNIIKINIIAMILTLICTSCAPFSKIDPKANANTKPKKITNPGENTQNFEDKSGD
LSTSDEKIMETIASELKAIGKELEDQKKEENIQIAKIAKEKFDFLSTFKVGPYDLIDEDI
QMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLEL
IQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQNTQDNEKILAEHFNKYY
KDFDTLKPAFY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagccaaactaaatataatcaagattaatattattgcaatgatattaacttta
atttgcacctcatgcgcaccttttagcaaaatcgatcctaaagcaaatgcaaacactaag
ccaaaaaaaatcaccaatccgggggaaaacacccaaaattttgaagataaatctggagac
cttagcacttctgatgaaaaaattatggaaactatcgcttcagagctaaaagcaattggt
aaggaactggaagatcaaaaaaaagaagaaaatatacaaatagctaaaattgctaaggaa
aaatttgatttcctaagcacttttaaagttggtccttacgatcttattgatgaagatatc
caaatgaaaataaaaagaacgctttactcatctttagattataaaaaagaaaatatagaa
aaattaaaagaaattcttgaaatacttaaaaaaaattccgaacattacaatataattgga
agattgatttatcacatatcatggggcattcaattccaaatagagcaaaatttagaatta
atacaaaatggagtagaaaatctaagtcaagaagaatctaaatcattgctaatgcaaata
aaatccaacttagagataaaacaaagacttaaaaaaaccttaaacgaaactcttaaagtt
tacaatcaaaatactcaagataatgagaaaatactggcagaacactttaataaatattac
aaagattttgatactttaaaacctgccttttactaa

DBGET integrated database retrieval system