KEGG   Borrelia burgdorferi B31: BB_B19Help
Entry
BB_B19            CDS       T00012                                 

Definition
outer surface protein OspC
Organism
bbu  Borrelia burgdorferi B31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
cp26:16903..17535
Genome map
AA seq 210 aa AA seqDB search
MKKNTLSAILMTLFLFISCNNSGKDGNTSANSADESVKGPNLTEISKKITDSNAVLLAVK
EVEALLSSIDEIAAKAIGKKIHQNNGLDTENNHNGSLLAGAYAISTLIKQKLDGLKNEGL
KEKIDAAKKCSETFTNKLKEKHTDLGKEGVTDADAKEAILKTNGTKTKGAEELGKLFESV
EVLSKAAKEMLANSVKELTSPVVAESPKKP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatacattaagtgcaatattaatgactttatttttatttatatcttgtaat
aattcagggaaagatgggaatacatctgcaaattctgctgatgagtctgttaaagggcct
aatcttacagaaataagtaaaaaaattacggattctaatgcggttttacttgctgtgaaa
gaggttgaagcgttgctgtcatctatagatgaaattgctgctaaagctattggtaaaaaa
atacaccaaaataatggtttggataccgaaaataatcacaatggatcattgttagcggga
gcttatgcaatatcaaccctaataaaacaaaaattagatggattgaaaaatgaaggatta
aaggaaaaaattgatgcggctaagaaatgttctgaaacatttactaataaattaaaagaa
aaacacacagatcttggtaaagaaggtgttactgatgctgatgcaaaagaagccatttta
aaaacaaatggtactaaaactaaaggtgctgaagaacttggaaaattatttgaatcagta
gaggtcttgtcaaaagcagctaaagagatgcttgctaattcagttaaagagcttacaagc
cctgttgtggcagaaagtccaaaaaaaccttaa

DBGET integrated database retrieval system