KEGG   Borrelia burgdorferi B31: BB_F01Help
Entry
BB_F01            CDS       T00012                                 

Definition
hypothetical protein
Organism
bbu  Borrelia burgdorferi B31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
lp28-1:467..1465
Genome map
AA seq 332 aa AA seqDB search
MKLLKIFMCAFLLLNLVNCKFDSLNLSTKSVDDKNNSIAKLLQHLSKSEDQANKTSTSED
QKELEITENKEQEHEKLSQVAQHAPNSKIEKVKSDGKPVPGDKILSSNKDIYNSYIPEVK
EEIVYEILEEVIIPETKIPEITEEVIMPIPQTIDFYIEPRPISSFLTQGTSPSITSTIKS
YKELAKEKINNGLNIVQKITQNIDNITENLNSKETPKEISGKEVEEKITHPIFDHITGSG
NNPGQDSISNTWGEGLEIGGDSNFFTNLEEVRSSIRTKIKVSDGTEQTKDKVEIDEIIED
LQKLKEFLEKLKKYLKDTNNLSAIEESVKGLS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattattaaaaatatttatgtgtgcttttttacttttaaatttagtaaattgtaaa
tttgatagtcttaatttatctacaaaaagcgtagatgacaaaaacaattctatagccaag
cttcttcaacacttatcaaaaagtgaagaccaagccaataaaacttctacctcagaagac
caaaaggaattagaaattacggaaaacaaagaacaggaacatgaaaaactttcacaagta
gcacaacatgctccaaactcaaaaattgaaaaagtaaaatccgatggaaaacctgttcct
ggggacaaaattctttcttcaaataaagatatttacaattcttatatcccagaagtaaaa
gaggaaattgtttatgaaattcttgaagaagtgataattcccgaaacaaaaattcctgaa
attactgaagaagtgataatgcctattccacaaacaatagatttttatattgaaccaagg
ccaataagtagtttccttactcaagggacatcaccaagtattacaagtacaataaaatca
tataaagaactcgctaaagaaaaaattaataatggcttgaatatagtacagaaaataact
caaaatattgataatattacagaaaatttaaattctaaagaaacaccaaaggaaatatcg
gggaaagaagttgaagaaaaaattacacaccccatatttgatcacattactggaagcggt
aataatcccggacaagattctatatccaatacatggggcgaaggacttgaaattggtggt
gatagcaatttctttaccaatttagaagaagtaagaagctctataagaacaaaaatcaaa
gtttctgatggcactgagcaaaccaaagacaaggtggaaatagatgaaattatagaagat
ttgcaaaaactaaaagaatttctagaaaaactcaagaaatatcttaaagatacaaataat
cttagcgcaatcgaagaaagtgtaaagggtttaagttaa

DBGET integrated database retrieval system