KEGG   Borrelia burgdorferi B31: BB_H32Help
Entry
BB_H32            CDS       T00012                                 

Definition
antigen P35
Organism
bbu  Borrelia burgdorferi B31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
lp28-3:21470..22219
Genome map
AA seq 249 aa AA seqDB search
MKYNTIISIFVCLFLTACNPDFNTNKKRTLSKGIISNQDADSDKIIKNKLLDDLINLIEK
ANADREKYVKKMEEEPSDQYGMLAVFGGMYWAESPRELISDTGSERSIRYRRRVYSILLN
AIETNELKKFSEIRILSIKVLEIFSLFNLFGSTLDDVVVHLYSKKDTLGKLDISNLKRLK
NLFEKLLSIKTIVSKMSKRLLLDYQNNENFIKTDNAKLGSYVVALSNQIQEKYNEAERLK
SEIILIYTL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataatacgattataagcatatttgtttgtttgtttttaactgcttgcaatcca
gattttaacacaaataagaaaagaactctaagtaaggggataatttcaaatcaagatgca
gattctgataaaataataaaaaataaattacttgatgatttaataaatttaatagaaaaa
gcgaatgcagatagagaaaaatatgtaaaaaaaatggaagaagaaccttcggatcaatat
ggaatgttggctgtttttggaggtatgtattgggcagaatcaccacgggaattaatatct
gatacaggtagtgagagatctattaggtatagaaggcgtgtttatagtattttattaaat
gctattgaaactaatgaattaaagaaattttcagaaattagaatactgtcaataaaagta
ctagaaatatttagcctatttaatctatttggaagtactcttgatgatgtggttgttcac
ttatattccaaaaaagatactctaggtaaactagatatttcaaatttaaaaagacttaaa
aatttgtttgaaaaattattatctataaaaacaatcgtttcaaagatgtcaaaacgtctt
ttattggattatcaaaataatgaaaattttataaaaacagataacgccaagcttggatct
tatgtggttgcactttccaatcaaattcaagaaaaatataatgaagcagaaaggctgaaa
agcgagataattttaatatataccctttaa

DBGET integrated database retrieval system