KEGG   Borrelia burgdorferi B31: BB_L39Help
Entry
BB_L39            CDS       T00012                                 

Gene name
erpN
Definition
ErpN
Organism
bbu  Borrelia burgdorferi B31
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
cp32-8:26382..26903
Genome map
AA seq 173 aa AA seqDB search
MNKKMKMFIICAVFILIGACKIHTSYDEQSNGEVKVKKIEFSEFTVKIKNKNNSNNWADL
GDLVVRKEKDGIETGLNAGGHSATFFSLEEEEINNFIKAMTEGGSFKTSLYYGYNDEESD
KNVIKNKEIKTKIEKINDTEYITFLGDKINNSAGGDKIAEYAISLEELKRNLK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaatgaaaatgtttattatttgtgctgtttttatacttataggtgcttgc
aagattcatacttcatatgatgagcaaagcaatggagaggtaaaggtcaaaaaaatagaa
ttctctgaatttactgtaaaaattaaaaataagaataatagtaataactgggcagactta
ggagatttagttgtaagaaaagaaaaagatggtattgaaacgggtttaaacgctggggga
cattcggctacattcttttcattagaagaggaagaaattaataactttataaaagcaatg
actgaaggtggatcatttaaaactagtttgtattatggatataatgacgaagaaagtgat
aaaaatgtcattaagaataaagagataaaaacaaagatagaaaaaattaatgatactgaa
tatattacatttttaggagataaaattaataacagtgcggggggagacaaaatagctgaa
tatgcaatatcactagaagagcttaaaagaaatttaaaatag

DBGET integrated database retrieval system