KEGG   Borrelia burgdorferi CA382: L144_03895Help
Entry
L144_03895        CDS       T02794                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bbur  Borrelia burgdorferi CA382
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbur00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    L144_03895
Enzymes [BR:bbur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     L144_03895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829227..830330
Genome map
AA seq 367 aa AA seqDB search
MGFCLDFANKEDTKLNNIVSVSHFDFRVKINLILVVGPMGSGKTEYAAKIYKDSLVVRKK
SFKVLGNIIKGNRSRVNVFFIRNFLDKRRFQDYPENVIPYRGGGKDKIDEIGYASNSFDI
ENLIASNPSCGTFIIDEACFYDERLIFVLNKISSNENILFILPTLLYNFRKESFNDTAKL
LVEYSDKIYKLGAYCGHIDCMEESFFSYRYYFYNNKEIPAPYFDPLLIVGGDEEIESAIY
PNYSTRCSMHHYLIGKEYFFSFLKPFALLYSQGDKKFLENEIVALSTDVENSNFVNSLDS
EKAREFRAEILRNILELPFLAERALITLFSEYSILSKDNFKDLVFKFSLNKDYINKIFFS
KEGKEFF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttttgtttagactttgctaataaagaagatactaaattaaataacattgtctct
gttagtcattttgattttagggtaaaaataaacttaattcttgtagttggacccatggga
agtggaaaaacagaatatgctgcaaaaatttataaagattcgcttgttgtaagaaaaaaa
tctttcaaggtattgggcaatattattaaaggaaatagaagtagggttaatgtatttttt
attagaaattttctcgacaagaggaggtttcaagattatccagaaaacgtaataccatat
agaggcggtggaaaagataaaattgatgagattggttatgctagcaactcttttgatatt
gaaaatttaatagcctctaatcctagttgtggcacttttattattgatgaggcatgtttt
tatgatgaacgtttaatttttgttttaaataaaatttcatcaaatgagaatattttattt
atattacctacactgctttataattttagaaaagaatctttcaatgatactgccaaactt
ttagtagaatattcagataagatttataagcttggagcttattgtgggcacattgattgc
atggaagaatcttttttttcgtataggtattatttttacaacaataaagaaattccagct
ccttattttgatcctttgcttattgttggtggcgatgaagagattgaatctgctatttac
ccaaattactctacaagatgttcaatgcaccattatcttataggtaaggaatattttttt
tcttttttaaagccatttgctttgctatattcacaaggagataaaaaatttcttgaaaat
gaaattgtagcactaagcactgatgttgaaaattctaattttgtaaattctttagatagt
gaaaaagcgcgtgaatttagagccgaaattttaagaaatattttagaattgcctttttta
gcagaaagagccttaataactcttttctcagaatatagtattttgagtaaggataatttt
aaagatcttgtttttaagttttctttaaataaggattatataaataaaatttttttttcc
aaagagggcaaagagtttttttaa

DBGET integrated database retrieval system