KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0073Help
Entry
HMPREF9228_0073   CDS       T01844                                 

Definition
putative lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HMPREF9228_0073
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HMPREF9228_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90925..92016
Genome map
AA seq 363 aa AA seqDB search
MQVTMIDENKYAETMTDVVLPALEQCRDEGWYDPSAAERSAGIEPLSGIMDTGGRSGQLH
YLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEHRGH
GKSSRDVENPCMVWIDDWRRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGALVLEQ
YPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFGEKRVFGQSDFTPEFSMEGNEG
ASEARERWYFKLRCENREYQTYCAAFEWVRQALKMNRAVLSPTACAEVETPVLLFQSGRD
IWVLNNPQNRFVQLVKDGGGEADMVRYPESLHEIFSMPNAIYKPYLERILSFYDDPMIAS
ATY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgatgatcgacgaaaacaagtacgccgaaacgatgacggacgtggtgctg
cccgccctcgagcaatgccgagatgaaggctggtacgacccgtccgctgccgagcgatcg
gctggtattgagccgctttccggcattatggatacaggcggacgctctggtcaactgcac
tacttgtgctacgactcggccaagttcgacgcaattcgcgagcaaggcgccaccgccacc
ttccgcggggccatcgtcatcagccacgggttcaccgagttcgcggaaaaatatgacgag
ctggtctggtacttcctgcttgccggctattcggtatgtgtgctcgagcatcgtggacac
ggcaaatcttcccgcgacgtcgagaacccatgcatggtgtggatcgatgattggcgccga
tatgtggccgatttggccggcttcgccgaaaccatcggccagcagtacgcggccggcatg
ccgctgaacctgttctgccactcgatgggcggcggcatcggcgcactggtgcttgagcag
tatccgaccttgttcgacaaggcggtgctctccgccccgatgatcgcccccgccactggt
atgccgttgggcgtggcccgtgtgctggtcggcgcgctgtgcggtctggggttcggcgaa
aagcgcgtgttcggacagtccgacttcaccccggaattctccatggaaggcaacgagggc
gcctccgaggcgcgtgaacgctggtatttcaaactgcgttgcgagaaccgtgagtatcag
acctattgtgcggccttcgaatgggtgcggcaggcgctgaagatgaaccgggctgtgctc
agccccaccgcctgcgccgaagtggagacgccagtgctgctgttccagtccggacgcgat
atctgggtgctcaacaatccgcagaaccgtttcgtccaactggtcaaggacggcggcggc
gaggcggacatggtgcgttaccctgaatcgctgcatgagattttctcgatgccgaacgcc
atctacaagccgtacctcgagagaatcctgagcttctacgacgatccgatgattgccagc
gccacgtactga

DBGET integrated database retrieval system