KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0103Help
Entry
HMPREF9228_0103   CDS       T01844                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
127824..129350
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHVLPFFTPFDGADAGFDPIDHTK
VDPRLGSWDDVAELSKTHSIMVDAIVNHMSWESAQFQDVLKNGERSEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGMKRGLEILIEVHSYYKKQ
VGIASKVDRVYDFALPPLLLHSLFTGHVEPVAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELTAFNGEFSYEADGDTSITFRWIAADGKTKAALIFEPGRGLGTDNTTP
VASLAWTDAAGDHETDDLLSNPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcatcgcttacgccgatcgtctcggcgatggtactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtccatgtcctg
ccgttcttcactccgttcgatggtgcggacgctggcttcgacccgatcgaccacaccaag
gtcgacccgcgcctcggatcgtgggacgacgtcgctgaactttccaagacccacagcatc
atggtcgatgccatcgtcaaccacatgagctgggaatccgcccaattccaagacgtgctg
aagaacggcgagcgctccgagtattacccgatgttcctgaccatgagttccgttttcccg
aacggcgccaccgaagaggatctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacccgtctggtatgggtcagcttcactccgcagcag
gttgatattgacaccgattccgacaagggctgggaatacctcatgtccatcttcgatcag
atggccgcatcccacgtcagctacattcgtctcgacgccgtcggctacggcgctaaggaa
gccggcaccagttgctttatgactccgaagacattcaagctcatctcgcggctgcgtgag
gaaggcatgaagcgcggtctggagatcctcatcgaagtgcactcctactacaaaaagcag
gtcggaatcgcatccaaagtcgaccgcgtgtacgacttcgctctgccgccgctgcttctg
cactcgctgttcactggccatgtcgaacccgtggcgcattggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgacggcatcggcgtgatcgacatcggctccgat
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggacgtcgataatctggtcaac
accatccacgccaacacccacggcgaatcccaggccgccaccggtgccgccgccagcaac
ctcgacctctatcaggtcaacagcacgtactactccgcgctcggctgcaacgaccagcac
tatctggccgcccgcgcagtccagttcttcctgcccggagtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgcaagaccaataacggccgtgac
atcaatcgccattactactccaccgccgaaatcgacgaaaacctcgagcgcccggtggtg
aaggccctgaacgccctggccaagttccgcaacgaactgactgcattcaatggcgagttc
agctacgaagccgacggcgacacatccatcaccttccgctggatcgctgccgacggcaag
accaaggccgccctcatcttcgagcccggccgcgggctcggcacggataacaccactccg
gtcgccagcctcgcctggaccgatgccgccggtgaccacgagactgatgatctgctgagc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system