KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0103Help
Entry
HMPREF9228_0103   CDS       T01844                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9228_0103 (gtfA)
Enzymes [BR:bbv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HMPREF9228_0103 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
127824..129350
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHVLPFFTPFDGADAGFDPIDHTK
VDPRLGSWDDVAELSKTHSIMVDAIVNHMSWESAQFQDVLKNGERSEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGMKRGLEILIEVHSYYKKQ
VGIASKVDRVYDFALPPLLLHSLFTGHVEPVAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELTAFNGEFSYEADGDTSITFRWIAADGKTKAALIFEPGRGLGTDNTTP
VASLAWTDAAGDHETDDLLSNPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcatcgcttacgccgatcgtctcggcgatggtactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtccatgtcctg
ccgttcttcactccgttcgatggtgcggacgctggcttcgacccgatcgaccacaccaag
gtcgacccgcgcctcggatcgtgggacgacgtcgctgaactttccaagacccacagcatc
atggtcgatgccatcgtcaaccacatgagctgggaatccgcccaattccaagacgtgctg
aagaacggcgagcgctccgagtattacccgatgttcctgaccatgagttccgttttcccg
aacggcgccaccgaagaggatctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacccgtctggtatgggtcagcttcactccgcagcag
gttgatattgacaccgattccgacaagggctgggaatacctcatgtccatcttcgatcag
atggccgcatcccacgtcagctacattcgtctcgacgccgtcggctacggcgctaaggaa
gccggcaccagttgctttatgactccgaagacattcaagctcatctcgcggctgcgtgag
gaaggcatgaagcgcggtctggagatcctcatcgaagtgcactcctactacaaaaagcag
gtcggaatcgcatccaaagtcgaccgcgtgtacgacttcgctctgccgccgctgcttctg
cactcgctgttcactggccatgtcgaacccgtggcgcattggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgacggcatcggcgtgatcgacatcggctccgat
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggacgtcgataatctggtcaac
accatccacgccaacacccacggcgaatcccaggccgccaccggtgccgccgccagcaac
ctcgacctctatcaggtcaacagcacgtactactccgcgctcggctgcaacgaccagcac
tatctggccgcccgcgcagtccagttcttcctgcccggagtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgcaagaccaataacggccgtgac
atcaatcgccattactactccaccgccgaaatcgacgaaaacctcgagcgcccggtggtg
aaggccctgaacgccctggccaagttccgcaacgaactgactgcattcaatggcgagttc
agctacgaagccgacggcgacacatccatcaccttccgctggatcgctgccgacggcaag
accaaggccgccctcatcttcgagcccggccgcgggctcggcacggataacaccactccg
gtcgccagcctcgcctggaccgatgccgccggtgaccacgagactgatgatctgctgagc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system