KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0115Help
Entry
HMPREF9228_0115   CDS       T01844                                 

Definition
(GenBank) sortase family protein
  KO
K07284  sortase A [EC:3.4.22.70]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.70  sortase A
     HMPREF9228_0115
Peptidases [BR:bbv01002]
 Cysteine Peptidases
  Family C60
   HMPREF9228_0115
Peptidoglycan biosynthesis and degradation proteins [BR:bbv01011]
 Peptidoglycan biosynthesis and degradation
  Sortase
   HMPREF9228_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sortase RDD DUF4381
Motif
Other DBs
NCBI-ProteinID: AEF26877
Position
150573..151481
Genome map
AA seq 302 aa AA seqDB search
MFTVLSVLFLLIGFAIITTPFVMRAISEYQQNATVQQTQREVDGWPYPQAENQLKTAREY
NKKLVAGGQAAIGEVKDPFASNAGQSTTSGADDSMAAKDQEYQSLLDAGQGVMGSIRIPK
IDVNLPIYHGTSEDALAVGAGHLYGTSLPVGGKSTHSVITGHRGLPNSLLFTRLDEMKKG
DSFYIEVMGKTLGYKVDRITVIKPDDSSKLRITKGEDRVTLMTCTPYGVNSHRLLVSGVR
AEIPEEVPDPDDVHGINTTWLALGAIVFLAMLLAFIVILMRRKQKRDREFAGLARHAARP
TK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtttactgtgctgtcggtgctgtttttgctgatcgggtttgccatcatcaccacgccg
ttcgtcatgcgcgccatcagcgaataccagcagaacgccaccgtgcagcagacgcagcgc
gaggtggatggctggccgtacccacaggcggagaaccagctcaaaaccgcccgcgagtac
aacaagaaactcgtggctggcggccaggccgccatcggcgaggtcaaagatccttttgcc
agcaatgccggccagtccaccacttccggcgcggatgattcgatggccgccaaagatcaa
gaatatcagagtctgctcgacgccggccaaggcgtgatgggctctatccgcattcctaaa
atcgacgtcaacctgcccatataccacggcaccagcgaagatgcgctcgccgtgggcgcg
ggacacctttatggcacttcattgccggtcggcggcaaatccacacactctgtaatcacc
ggccatcgcggtttgccgaactcgttgctgttcactcgccttgatgagatgaagaagggt
gattccttctacatcgaggtcatgggcaagacactcggctacaaggtcgaccgcattacc
gtgatcaagcccgacgattccagcaaactgcgcatcaccaaaggcgaggatcgcgtaacc
ctcatgacctgtacgccttatggtgtcaattctcatcgcctactggtctccggtgtgcgt
gccgaaatcccggaggaagtgcctgacccggacgatgtgcatggcatcaacaccacatgg
ctggcactgggagccatagtgtttttggccatgctgctcgctttcatcgtcatattgatg
cgacgtaagcaaaagcgcgatcgggaatttgccggcctcgcccggcacgccgcacgtccg
acaaaataa

DBGET integrated database retrieval system