KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0118Help
Entry
HMPREF9228_0118   CDS       T01844                                 

Definition
(GenBank) ABC transporter, solute-binding protein
  KO
K15770  
arabinogalactan oligomer / maltooligosaccharide transport system substrate-binding protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
ABC transporters
Module
arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    HMPREF9228_0118
Transporters [BR:bbv02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    HMPREF9228_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
156398..157639
Genome map
AA seq 413 aa AA seqDB search
MKIDWEKAIGLTAAAAMLLPLAACGGSNNAGDAKSGGTEDVTLSVWAPQEDQDGGNDSWL
SQVEANFEKEHPEYKITWKNDVLSEGDAATQVQTDPTAAADVYMFASDQLGALMKAQGIG
ELGSDAEKQVKEQNGDLEVASVTGSDGKMYGVPYTDNTWFMYYDKSTFSEDDIKSLDTMV
SKAAVAFPLNDSWYIGGFYDGLTLFGEDGTDPDAGMVFPKDAGDITKYLVDLAANPNFHN
SADNSGLSEMQSGTVKAFFSGSWSAADIKEALGANMGVAQLPTFTVNGTPKQMKSFAATK
AAAYNPNAKNPKAAAQFAAYLGSTESQKLHYTVRNIIPTDKTLTDLTADDPVAIGQTDTM
ANTAILQSGLAGMADWWDPAKAFGDAILNKEVTVDNAQAKTDAWVEQVGSYAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgattgggagaaggctatcggcctcactgctgccgcagctatgttgctgccc
ctcgccgcatgtggtggctccaacaatgccggcgacgcaaagtccggcggcactgaagat
gtgaccctgagcgtgtgggccccgcaggaggaccaggacggcggcaacgactcctggctg
agccaggtcgaagccaacttcgagaaggagcaccccgagtacaagatcacttggaagaac
gacgtgctctccgagggcgacgctgccacccaggtccagaccgatccgaccgccgccgcg
gacgtctacatgttcgcctccgatcagctcggcgctttgatgaaggcccagggcatcggc
gagctcggctctgacgctgaaaagcaggtcaaggagcagaatggcgatctggaagtcgcc
tccgtgactggctccgacggcaagatgtacggcgtgccctacaccgacaacacctggttc
atgtactatgacaagtccaccttctccgaggatgacatcaagagcctcgacactatggtc
tccaaggctgcggtcgccttcccgctcaacgattcctggtacatcggtggcttctacgat
ggcctgaccctcttcggtgaggacggcaccgacccggatgccggcatggtgttcccgaag
gacgccggcgacatcaccaagtacctggtcgaccttgccgccaacccgaacttccacaac
agcgccgacaactccggcctgtccgagatgcagtccggcaccgtcaaggccttcttctcc
ggctcctggtccgctgccgacatcaaggaagccctcggcgccaacatgggcgtcgcccag
ctgccgaccttcaccgtgaacggtacaccgaagcagatgaagtccttcgccgccaccaag
gccgccgcctacaacccgaacgccaagaacccgaaggccgctgcccagttcgccgcttac
ctcggctccaccgagtcccagaagctgcactacacggtgcgcaacatcatcccgaccgac
aagaccctcaccgatctgaccgccgatgacccggtggccatcggacagaccgataccatg
gccaacaccgccattctgcagtccggtctggccggcatggctgattggtgggatccggcc
aaggccttcggcgacgccatcctcaacaaggaagtcaccgtagacaacgctcaggccaag
accgacgcctgggtcgagcaggtcggttcctacgccaagtga

DBGET integrated database retrieval system