KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0121Help
Entry
HMPREF9228_0121   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX
Motif
Other DBs
NCBI-ProteinID: AEF27501
Position
160481..161284
Genome map
AA seq 267 aa AA seqDB search
MNEVEMAKQRRGEKRRRKGLSVFRLKMIGALFMALGVAGVSVLPSMLGDPTQDMAALTVV
VACAAASWCAIPIYSWLLFDGYRHTGSIGKYVLRLFIVAVVSDVPYDLIMTGKPFDLSAQ
NSVYGLVIALVVLMLVDWIAYQYGGESLRPWSGAQRGGAAAVRWLLTIVVILAGLLWALL
LRVGVDQRIMHTGVLTLLFVLVFYFLNARENTMMFTAGLLGAVMCITPGIGVAFLHYRND
EVGFKQSWTKWAWYAVYPVLLIIGALA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtggagatggcaaagcagcggcgtggtgagaagcgccgccgcaagggcctg
tccgtattccgtctcaagatgatcggcgccctattcatggcattgggcgtggccggcgtc
tcggtcctgccgtccatgttgggcgacccgactcaggacatggctgcactgaccgtggtg
gtggcgtgcgcggcggcttcatggtgcgccatccccatctactcatggctgctgttcgac
ggctaccggcatacgggcagcattggaaaatatgtgctccgtctgttcatcgtcgcggtg
gtcagcgatgtgccgtacgacctgattatgaccggcaagccattcgacttgagcgcgcag
aactcggtgtatggcttggtcatcgccctggtcgtgctcatgctggtggattggattgca
taccagtacggcggggagagtctgcgcccgtggtccggtgctcagcgaggtggtgcggct
gcggtgcgttggctgctgaccattgtagtcattctggccggactgctgtgggcgttgctg
ctgcgcgtgggcgtggatcagcggattatgcatactggtgtgctgacgctgctgtttgtg
ctggtgttctacttcctgaacgcgcgtgaaaatacgatgatgttcaccgccgggctgctg
ggtgccgtgatgtgcattacgcccggtattggtgtggccttcctgcactaccgcaatgac
gaagtcgggttcaagcagtcttggaccaagtgggcctggtacgcggtctatccagtgctt
ttgattatcggcgcgctggcctag

DBGET integrated database retrieval system