KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0123Help
Entry
HMPREF9228_0123   CDS       T01844                                 

Gene name
pulA
Definition
(GenBank) pullulanase, type I
  KO
K01200  
pullulanase [EC:3.2.1.41]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9228_0123 (pulA)
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     HMPREF9228_0123 (pulA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
162629..167719
Genome map
AA seq 1696 aa AA seqDB search
MAVRRFSSLAKRLAVTGIAVAMSATTLVALPASADETEANAQARTSVGAPGDVIAIAFQT
NWNSVAKECTEAYGPEGVAYVQVSPPMESIQGTEWWTSYQPVSYKLDSKLGTEAEFKTMI
ATCNAAGVEIIADSVINHTTGADQGEGTGVAGSKYDGEGNFPAIPYTKENFHDCTKNIGD
YTNADEVQNCRLTSLQDLDTSQEYVQDKLADYMNRLLDLGVYGFRVDAVKHIATADVAAI
KAKLAEKSGRNADDIFFEQEVIGNASEAAEIQPSNYVANGKVSEFNFTNHLSVAFAGDIT
DASKGLANVGGDGWVSSDKAAVWVTNWDTERGSAITYKKGSKYLLANAFMLAYDYGQPHI
YSGYYFDNSDDGAPGATETSVPDMECPTDGSMTSGTWQCAERWTAIRGMIGFHNAVNGTD
VTNWKAYDTNVLGFGRGDVGYLALNNSADDSKQTFQTSLPAGEYCNVYATGDCSATVTVK
DDGTFDATLAKNSAIAIYAGATKDSWTGTTKSDPSDPDLSVNDETKKATADTSRTIYYKL
PDGWKQAYLHYGIDGWAERGHELMADAGNGWVKFTVDPKGKSFEYVFTDGGDNWDNPNGG
GNYTAQGHWTAVADHEASAGVPSDVQSYQPKTKVIVHYKPAEGDAVADRGVYMWGTDKNG
ATLNGAWHAFTGEDSYGKVFETTIDGAYDAAKIGVIVTTEGWDKVGSDRTIDGSTGTAEI
WVDGANPDETLTEAPDGYKKAANQIDVTIHYHRLADDYTSEDGMKAWDIWGWADGVNGAA
YPFTEHDDYGLIAKYTLKGSGMSALQFIVRYGGDSWEAKDPNDENRTIPQSAITVNADGT
ASAEIWLVQGDTTIYTNGTLYDAKGTIVSAEMTDFNTITVKLNKALTIDKPADAVSVEGA
KIKDVKASGNTVTITAADNLDVTKAYKVTIEDYGTQTVSLGAVVRSDAFDKKYAYDGDDL
GVTYKAEKSTFKLWAPTATKVTLRLYADSTDPKAAQTDAVTLEKSGKKGVWTFAVDKDLK
DYAYDYELTFADGTVNTSADPYATAAVANGERSVVLSDKEKGYAGKRMASFSKPTDAIIT
EANVRDMTINPNSGVSEANRGKYLGFVEEGTTVDGKQGAAPTGIDYLKSLGVTHVQIMPV
YDYGSVDETGDLSYGAQYNWGYDPENYNVPEGSYSSDPSDPSARVKEMKQMVSGLHKNGL
YVVMDVVYNHVYNASEHAFNKTVPGYYFRYDANGNLTNGSGCGNDVASERAMARKYIVDS
VKYWATEYNVDGFRFDLMGLIDQTTMNQVRAALDEIDPSMLVIGEGWDMTDAIGNQETTQ
PNASKVKGVAFFNDSLRDAIKGSVFSDEDTGFIAGKADKENLIATNVLGCNNKREGIDEN
GHCNNGTADTNYGGADQVVQYVEIHDNLTLYDKLVKSAPNDSEETRLARAKLADSLILLS
QGITDMQFGQEFLRTKGGNGNSYNAGDAVNAIDWNRTVEQAGSVNYVKGLIALRKSIKNL
HLSSYDDIAKNMTVLQQSDGVVAYQLKDGSDTYVVVFNANESAATVEAVPAGKYTVLAAD
GKVTETQDKNAATTVGADGYQAGALAAAVLKAGVDDDSTKPDGGKDDNQSGGAATPGTPG
DSGNGNGQTGDGNASNGASDTAAGQSQQFGAAALPNTGVALSVMAVAVLVMTAAGMLLQR
FSKGGNVVNSKEGSEQ
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atggccgtacgacgattcagctcgctcgccaaacgccttgccgtaaccggcatagcggtg
gcaatgtctgccacaacgctggtagcattgccggcttctgcggacgagaccgaggccaat
gcacaggcgcgcacatctgttggcgcgccgggcgatgtgatcgccatcgcattccaaacc
aactggaattcggtggccaaggagtgtaccgaggcttacggccccgaaggtgtggcctac
gtacaggtctccccgccgatggagtccatccagggcactgaatggtggacctcctatcag
ccggtcagctacaagctcgactccaagctcggtacggaagccgagttcaagaccatgatc
gccacgtgcaacgcggcgggcgtcgagatcatcgccgactcggtcatcaaccacaccacc
ggcgccgatcagggcgagggcaccggcgtcgccggcagcaagtacgacggcgagggcaac
ttccccgcaatcccgtacaccaaagagaacttccacgactgcaccaagaacatcggcgac
tacaccaacgccgacgaagtacagaactgccgcctgaccagcctgcaggacctcgacacc
agccaggaatacgtgcaggacaagctcgccgactacatgaaccgcctgctcgacctcggc
gtctacggattccgcgtcgacgcggtcaaacacatcgccacggccgacgtggccgccatc
aaggccaagctcgccgagaagtccggccgcaacgccgacgatatcttcttcgagcaggaa
gtcatcggcaacgcctccgaagccgcggaaatccagccgagcaactatgtggcgaacggc
aaggtctccgaattcaacttcaccaaccacctgtcggtcgccttcgccggcgacatcacc
gacgccagcaagggccttgcgaatgtcggcggcgacggctgggtgagctccgacaaggcc
gcagtgtgggtgaccaactgggataccgagcgcggatcggccatcacctacaagaagggc
tcgaagtacctgctcgcgaacgcgttcatgctcgcgtacgactacggccagccgcacatc
tactccggctactacttcgacaactccgacgacggtgctcccggcgccaccgaaacctcc
gtgcccgacatggagtgcccgaccgacggctcgatgacctccggcacctggcagtgcgcc
gaacgttggaccgcgatccgcggcatgatcggcttccacaacgcggtcaacggcaccgac
gtcaccaactggaaggcgtacgacaccaacgtgctcggcttcggtcgcggcgacgtcggc
tacctcgcgctcaacaacagcgccgacgactccaagcagacgttccagacgtcactgccc
gccggcgaatactgcaacgtgtacgccaccggcgactgctctgcaactgtgaccgtgaag
gacgacggcacgttcgacgcgacgctcgcgaagaattccgccatcgcgatctacgcgggc
gcgaccaaggattcctggaccggcacgaccaagtccgatccgtccgatccggacctgtcc
gtcaacgacgagaccaagaaggccacggccgacacgagccgcaccatctactacaagctg
cccgacggctggaagcaggcgtacctccactacggtatcgacggctgggccgagcggggc
cacgagctgatggccgacgccggcaacggctgggtcaagtttacggtcgatccgaagggc
aagtccttcgaatacgtattcaccgacggcggcgacaactgggacaacccgaatggcggc
ggcaactacaccgcgcagggccactggacggcggtcgccgaccacgaggccagcgccggc
gtgccctccgacgtgcagtcgtaccagcccaagaccaaggtgatcgtgcactacaagccc
gccgaaggcgacgccgtcgccgatcgcggcgtgtacatgtggggcaccgacaagaacggc
gccaccctgaacggcgcgtggcacgctttcaccggcgaggactcctacggcaaggtgttc
gagaccaccatcgatggtgcgtacgacgccgccaagatcggtgtgatcgtcaccaccgaa
ggctgggacaaggtcggcagcgaccgtaccatcgacggttccaccggcaccgccgaaatc
tgggtcgacggcgccaatccggacgaaacgctcaccgaagcccccgacggctacaagaag
gccgccaaccagatcgacgtgaccatccactaccaccgcctcgccgacgactacaccagc
gaagacggcatgaaggcatgggacatctggggctgggccgacggcgtcaacggtgctgcc
tacccgttcaccgagcacgacgactacggcctgatcgccaagtacacgctcaagggcagc
ggcatgagcgctctgcagttcatcgtgcgctacggcggcgacagctgggaagccaaggat
ccgaacgacgagaaccgcacgatcccgcagtccgccatcaccgtgaacgccgacggcacc
gcatccgccgaaatctggctggtgcagggcgacacgacgatctacaccaacggcacgctc
tacgacgccaagggcacgatcgtctccgccgaaatgaccgacttcaacaccatcacggtc
aagctcaacaaggcgctcaccatcgacaagccggccgacgcggtgtcggtcgagggtgcg
aagatcaaggacgtgaaggctagcgggaacaccgtgaccattaccgcggccgacaatctt
gacgtgaccaaggcctacaaggtgacgatcgaggactacggcacgcagaccgtgtcgctc
ggcgccgtcgtgcgctccgacgcgttcgacaagaagtacgcctacgacggcgatgatctt
ggcgtgacctacaaggccgagaagtccacgttcaagctgtgggcgccgaccgccaccaag
gtgacgctgcgcctgtacgccgactccaccgatccgaaggcggcgcagaccgacgccgtg
acgctggagaagtccggcaagaagggcgtgtggacgttcgccgtggacaaggatctcaag
gattacgcctacgactacgagctgaccttcgccgacggcacggtcaacacgtccgccgac
ccgtacgcgaccgccgccgtggccaacggcgagcgatccgtcgtgctctccgacaaggag
aagggctatgccggcaagcgcatggcgtcgttcagcaagccgaccgacgcgatcatcacc
gaggcgaacgttcgtgacatgaccatcaacccgaactccggcgtctccgaagccaatcgc
ggcaagtacctcggcttcgtcgaggagggcaccacggtcgacggcaagcagggcgcggcg
cccaccggcatcgactacctcaagtcgctcggcgtgacgcatgtgcagatcatgcccgtc
tacgactacggttccgtggacgagaccggcgatctgagctacggcgcgcagtacaactgg
ggctacgatccggagaactacaacgtgccggaaggctcgtactcctccgacccgagtgac
ccgagcgctcgtgtcaaggaaatgaagcagatggtctccggactgcacaagaacggcctg
tacgtggtgatggatgtggtctacaaccacgtctacaacgcctccgaacacgccttcaac
aagaccgtgcctggctactacttccgctacgacgccaatggcaacctgaccaacggctcc
ggctgcggcaacgacgtggcttccgagcgtgcgatggcccgtaagtacatcgtcgattcc
gtgaagtactgggcgaccgagtacaacgtggacggcttccgcttcgacctcatgggtctg
attgaccagaccaccatgaatcaggtgcgtgcggcgcttgacgagatcgatccgtcgatg
ctcgtcatcggcgaaggctgggatatgactgacgccattggcaaccaggaaaccacgcag
cccaatgcctccaaggtcaagggcgtggcgttcttcaacgactccctgcgcgacgcgatc
aagggcagcgtgttctccgacgaggacaccggcttcatcgccggcaaggccgacaaggag
aacctcatcgccaccaacgtgctcggctgcaacaacaagcgcgagggcatcgatgagaac
ggccactgcaacaacggcaccgccgacacgaactacggcggcgcggatcaggtggtgcag
tacgtcgagatccacgacaacctgactttgtacgacaagctggtcaagagcgcgcccaac
gactccgaggagacgcgactcgctcgcgccaagctcgccgactcgctgattctgctctcg
cagggcatcaccgacatgcagttcggccaggagttcctgcgcaccaagggcggcaatggc
aacagctacaacgccggcgacgcggtgaacgccatcgactggaaccgcacggtcgagcag
gcgggttccgtgaactatgtgaagggcctgatcgccctgcgcaagtccatcaagaacctg
cacctgagcagctatgatgacatcgccaagaacatgacggtgctgcagcagtccgacggc
gtggtggcctaccagctgaaggacggcagcgacacgtatgtggtggtgttcaacgccaac
gaatcggccgcaacggtcgaggccgtgccggctggcaagtacaccgtgctggccgccgat
ggcaaggtgacggagacgcaggacaagaatgctgcaaccaccgtgggcgctgacggctac
caggccggagcgctcgccgctgccgtgctcaaggccggcgtcgacgatgattcgaccaag
cccgatggcggcaaggacgataaccagtcgggcggcgccgccaccccgggtactccgggc
gatagtggcaacggcaatggtcagaccggtgacggcaacgcctccaacggcgcatccgac
accgcggccggccaatcccagcagttcggcgctgccgctctgcccaacaccggcgtagcc
ctgtccgtcatggcggtcgccgtattggtgatgaccgctgccggcatgctgttgcagcgg
ttctccaagggcggcaatgtcgtcaacagtaaggagggctccgaacagtag

DBGET integrated database retrieval system