KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0131Help
Entry
HMPREF9228_0131   CDS       T01844                                 

Definition
(GenBank) Acyl-CoA reductase (LuxC)
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxC
Motif
Other DBs
NCBI-ProteinID: AEF27130
Position
172899..173651
Genome map
AA seq 250 aa AA seqDB search
MIAGKVAGSKPCLGYGAKVGLAFIGREALRPDTYADTVHRVAVDIATYDQQSCLAPQTVF
VETDGALTAREVAQLLGGELENQQRKYPRSVLSDAENVAIQRARTDAEMRALMGGKAAVF
ASGHSTAWSVLYRELDGSGADEDVASLMSPLNRTVNVVAVPDLLDAARRLTSCRGWLQSC
GVAVDSTRLFGLADTLAEVGVNRICPLGEMDRAKSGWHHDGGFNLIDLLRAVDVERGSDA
YSDSFDMDME
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgattgcgggcaaagtcgccggatccaagccctgtctaggttacggagcaaaagtcggg
ttggcgttcattggccgagaggctttgcgccctgatacctatgccgataccgtgcatcgt
gtggctgttgacatcgccacatatgaccagcaaagctgcctggctccgcagaccgtgttc
gtggagactgatggagccctcaccgctcgtgaagtggctcagctgctcggtggcgagctt
gagaatcagcagcgcaaatatccgcgctccgtattgagtgacgccgagaacgtggccatt
cagcgggcgcgcaccgacgctgagatgagagctttgatgggcgggaaggccgcggtgttc
gccagtggccatagcacggcatggtcggtgctgtatcgagaacttgacggtagcggtgcc
gacgaggatgttgcttcgctgatgtcgccgttgaaccgcaccgtcaacgtggtggcggtg
ccagatttgttggacgctgccagaagattgacttcctgccgtggctggctgcagagctgc
ggtgtcgctgtggattcgaccagactgtttggtcttgcagatacattggccgaggtcggt
gtgaatcgcatctgtccgctcggtgagatggatcgggcgaaatccggctggcatcatgat
gggggcttcaacctcatcgatctgttgcgcgcggtggatgtcgaacgcggcagcgacgcg
tacagcgattcgttcgatatggatatggaatag

DBGET integrated database retrieval system