KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0133Help
Entry
HMPREF9228_0133   CDS       T01844                                 

Definition
(GenBank) HAD hydrolase, family IA, variant 3
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AEF27537
Position
174621..175292
Genome map
AA seq 223 aa AA seqDB search
MLLKAVFWDLDGTLIDSEPLWHDGEIEIAHNNGGEWNEDLGWECSGTPVPHVAEVMIAHG
CTLSVPEIDKQLKDYVFKAEVERLPWIPGAQDVLRSLKEADIPSMLVTTSPRRMAENIMK
QADGLLAGYVCGDDPYEHKPSPAPYLAAAERLGIAPEDMVKCVVMEDSSSGLRSGAASGA
TLIAQTGWIRTDTSGLGQFASIDSYEGIDAAALDAFVRQRLGE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcaaagccgtgttctgggatttggacggtactctcatcgattctgagccgctc
tggcatgacggtgagattgagatcgcgcacaacaatggcggcgagtggaacgaggacctc
ggttgggagtgctccggcactccggtgccacacgtggcggaggtcatgattgcgcatggc
tgcacattgagcgttcccgaaatcgacaagcagctcaaggattatgtattcaaggcggag
gtcgaacgtctgccgtggattcctggtgcgcaagacgtgctgcgttcgctcaaggaagcc
gacatcccatccatgctggtcactacttcgcctcgccgcatggccgagaacatcatgaag
caggctgatggattgcttgccggctacgtctgcggcgatgatccgtacgagcacaagccg
agccctgccccatatctggccgcggctgagagactcggcatcgcgcctgaagacatggtc
aagtgcgtggtaatggaagattcctcatccggtctgcgctccggcgccgcctcgggggcc
acactgattgcgcagactggctggattcgcaccgacacttccggccttggccagtttgcc
tccatcgactcgtatgagggcatcgacgcggccgcgctggacgcctttgtgcggcagcgt
ttgggggagtag

DBGET integrated database retrieval system