KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0141Help
Entry
HMPREF9228_0141   CDS       T01844                                 

Definition
(GenBank) TadE-like protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEF27839
Position
180790..181128
Genome map
AA seq 112 aa AA seqDB search
MAGVMLVMLVGVALSATACIGNLVVCQNRARSLADLIAFDAAYAAWHGWADDPCAFAGQL
AVSNSVALPDCMVQSDDVQVTVAVDTAVPLTPRVQRTALAGPAECDKGGASE
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgtcatgctggtcatgctggttggggtggctctttcggcaacggcgtgcatt
ggcaatctagtggtttgccaaaaccgggcacgttccctagctgacctcatcgctttcgat
gccgcctatgccgcatggcatgggtgggcggacgatccatgcgcgttcgcaggtcagctg
gccgtatccaatagcgtcgcattgcccgattgcatggtgcagtcggatgatgtgcaggtc
accgtggcagtggatactgcagtcccattgacgccgcgcgtgcagcgaacggctcttgcc
ggaccggcggaatgcgataagggaggtgctagtgagtaa

DBGET integrated database retrieval system