KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0147Help
Entry
HMPREF9228_0147   CDS       T01844                                 

Definition
(GenBank) DNA-binding helix-turn-helix protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_26 HTH_19 HTH_31 Phage_CI_repr FAM167
Motif
Other DBs
NCBI-ProteinID: AEF27064
Position
complement(187847..188449)
Genome map
AA seq 200 aa AA seqDB search
MKQQELADKIGINMQSLSKIERGVNYPTFDTLEKIMDVLGVTPNELLSGEWKYIDHTEPY
IMDIIKREQDFNVSLDYLSENEFFNDEKECRFYMETKLIQYIHNYITNEVTELEELMEIK
QLIQRQKIERMMKVHKEMRGLDRYREQPKEYKYHDPYDDWIFRQLADIDSRNNIPDTSPQ
LDFDETDYEDYLKEKWNRGL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaggaacttgcggataaaatcggtatcaatatgcagagcctttccaagatt
gaacggggtgtgaattatcctacctttgacacattagaaaagataatggacgtgctggga
gtaacgcccaatgaattattatcaggagaatggaagtatattgaccacaccgaaccatat
atcatggatattatcaaacgggaacaggacttcaatgtttccttagattatctgtctgaa
aatgaatttttcaatgatgaaaaagaatgcagattttacatggaaaccaaactcatacag
tatatccataactacattaccaatgaggttacggagttagaagaacttatggaaatcaag
cagttgatacaacgtcaaaaaatagaacgcatgatgaaagtacataaggaaatgcgaggg
ttagaccgatacagagaacagcccaaagagtataaataccatgacccttatgatgactgg
atattccgtcaacttgcggacatagacagcagaaataacattcccgacacttcgccacag
ttagattttgatgaaacggactatgaagattatctgaaagagaaatggaacagaggtctt
taa

DBGET integrated database retrieval system