KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0171Help
Entry
HMPREF9228_0171   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4862 ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AEF27419
Position
212196..213104
Genome map
AA seq 302 aa AA seqDB search
MPSFVVGAYASLPQGREAQETYYDLLGEQPWIEGTELPFPGDLADTADRIWLAGHLPKHW
RGNTVTVIPGTMQHVWKDPNFGLASPDEDGRKVALAFMKQLREALADFAQWRASQDVKFI
EIHSAPTRIASRDAMAASLEALAQLDWSGAKLVIEHCDKYVEGQKPEKGFLPIEDEIALC
GSAGIGLTVNWGRSVVEGRTPETAVAHVEAAAKAGVLSGLMFSGAGPEETQYGYGWIDGH
LPMNPDEPTSLMDAAAIKAAVRAAGAQERPLDYLGAKVCVPKDATVEERLDYLARIHEAV
VA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccatcattcgtcgtcggcgcgtacgcgtcattgccccaggggcgcgaagcccaggaa
acctactacgacctgctcggcgagcagccgtggatcgagggcaccgagctgcccttcccc
ggcgacctcgcggacaccgccgaccgcatctggctggccggccacctgcccaagcactgg
cgcggcaacaccgtcaccgtcatccccggcaccatgcagcacgtgtggaaggacccgaac
ttcggcctcgccagcccggacgaggacgggcgcaaggtcgcgctcgcgttcatgaagcag
ctgcgcgaggcgctcgccgacttcgcccagtggagggccagccaggacgtcaagttcatc
gaaatccactccgcacccacgaggatcgccagccgcgacgccatggccgcctcgctcgag
gccctcgcgcagctggattggtccggtgccaagctggtgatcgagcactgcgacaagtac
gtcgaggggcagaagccggaaaagggcttcctgccgattgaggacgagatcgcgctgtgc
gggtcggccggcatcgggctcaccgtcaactggggacgctcggtggtggaggggcgcacg
cccgaaaccgccgtggcgcacgtggaggccgccgcgaaggccggcgtgctgagcggcctc
atgttctccggcgccggcccggaggagacccagtacggctacggctggatcgacggccac
ctgcccatgaacccggacgagccgacctcgctcatggacgccgccgccatcaaggccgcc
gtgcgcgccgccggggcgcaggagcgcccgctcgactatctgggcgccaaggtgtgcgtg
cccaaggacgcgacggtcgaggagcgcctcgactatctcgcgcgcatccacgaggcggtc
gtcgcatga

DBGET integrated database retrieval system