KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0172Help
Entry
HMPREF9228_0172   CDS       T01844                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00010  Glycolysis / Gluconeogenesis
bbv00052  Galactose metabolism
bbv00500  Starch and sucrose metabolism
bbv00520  Amino sugar and nucleotide sugar metabolism
bbv00521  Streptomycin biosynthesis
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01120  Microbial metabolism in diverse environments
bbv01130  Biosynthesis of antibiotics
bbv01200  Carbon metabolism
Module
bbv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9228_0172
   00052 Galactose metabolism
    HMPREF9228_0172
   00500 Starch and sucrose metabolism
    HMPREF9228_0172
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9228_0172
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF9228_0172
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF9228_0172
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF9228_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEF26687
Position
213101..214108
Genome map
AA seq 335 aa AA seqDB search
MSAGAAPTYLAFDIGGTKVASGFVTLPANANAGADGRPEVTARCEIPTEAARGGEDLKNR
IVAFAVRQLERAEAEGVAIAGVGIAAAGVPDSETGEIVSATDILPGWRGQRIYDAFAAVT
DLPVHMIGDVGAHGLGEATYGAGRGRGVVLSIGVGTGIGGAIVVDGALFTGAHGVAGHAG
HVPSALGRGFLCSCGTLEGHIEPVASGTGLKDLYNRRCEEAGDENLPAADGAEVAARAAA
GEELARRTLTDSARALGECVGGMGNLIDPDVIVVSGSVVKAGPIWWDALRAGFADSALAL
VKSTPLVEGELGGAAPLIGAAAAVHRRIGAPDNAR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgggggcggcgcccacctacctcgccttcgacatcggcggcaccaaggtcgcc
tcgggattcgtgacgttgcccgcaaacgcaaacgcgggcgcggacggcaggcccgaggtg
acggcccgctgtgaaatcccgaccgaggccgcgcgcggcggcgaggacctgaagaaccgc
atcgtcgccttcgccgtccgccagcttgagcgcgccgaggccgagggcgtggcgatcgcc
ggcgtcggcatcgcggcggcgggcgtgccggacagcgaaactggcgagatcgtctccgcc
acggacatcctgcccggctggcgcggccagcgcatctacgacgcgttcgcggccgtgacc
gacctgccagtgcacatgatcggcgacgtgggcgcgcacggtctgggcgaggcgacgtac
ggcgccggacgcggcaggggcgtagtgctctcgatcggcgtgggcaccggcatcggcggc
gcgatcgtggtggatggcgccctgttcaccggcgcgcacggcgtggccggccacgcaggg
cacgtgccgagcgcgctgggccgcggattcctatgctcgtgcggcaccctcgaggggcac
atcgagccggtcgcgtccggcacggggctgaaggacctctacaatcggcgctgcgaggag
gccggcgacgagaacctcccggctgcggacggcgccgaggtggccgcccgcgcggccgcg
ggggaggagctggcccgccgcacgctcaccgacagcgcccgtgcgctcggcgaatgcgtc
ggcggcatgggcaacctcatcgacccggacgtgatcgtggtctccggctcggtcgtcaag
gccggtccgatctggtgggacgccctgcgcgccgggttcgccgattcggcgctcgcgctc
gtcaagtcgacgccgctcgtcgagggcgagctcggaggggcggcgccgctgatcggcgcg
gcggcggccgtccaccggcgcatcggcgcgccggacaacgcgcgatag

DBGET integrated database retrieval system