KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0172Help
Entry
HMPREF9228_0172   CDS       T01844                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9228_0172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9228_0172
   00052 Galactose metabolism
    HMPREF9228_0172
   00500 Starch and sucrose metabolism
    HMPREF9228_0172
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9228_0172
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF9228_0172
   00524 Butirosin and neomycin biosynthesis
    HMPREF9228_0172
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF9228_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213101..214108
Genome map
AA seq 335 aa AA seqDB search
MSAGAAPTYLAFDIGGTKVASGFVTLPANANAGADGRPEVTARCEIPTEAARGGEDLKNR
IVAFAVRQLERAEAEGVAIAGVGIAAAGVPDSETGEIVSATDILPGWRGQRIYDAFAAVT
DLPVHMIGDVGAHGLGEATYGAGRGRGVVLSIGVGTGIGGAIVVDGALFTGAHGVAGHAG
HVPSALGRGFLCSCGTLEGHIEPVASGTGLKDLYNRRCEEAGDENLPAADGAEVAARAAA
GEELARRTLTDSARALGECVGGMGNLIDPDVIVVSGSVVKAGPIWWDALRAGFADSALAL
VKSTPLVEGELGGAAPLIGAAAAVHRRIGAPDNAR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgggggcggcgcccacctacctcgccttcgacatcggcggcaccaaggtcgcc
tcgggattcgtgacgttgcccgcaaacgcaaacgcgggcgcggacggcaggcccgaggtg
acggcccgctgtgaaatcccgaccgaggccgcgcgcggcggcgaggacctgaagaaccgc
atcgtcgccttcgccgtccgccagcttgagcgcgccgaggccgagggcgtggcgatcgcc
ggcgtcggcatcgcggcggcgggcgtgccggacagcgaaactggcgagatcgtctccgcc
acggacatcctgcccggctggcgcggccagcgcatctacgacgcgttcgcggccgtgacc
gacctgccagtgcacatgatcggcgacgtgggcgcgcacggtctgggcgaggcgacgtac
ggcgccggacgcggcaggggcgtagtgctctcgatcggcgtgggcaccggcatcggcggc
gcgatcgtggtggatggcgccctgttcaccggcgcgcacggcgtggccggccacgcaggg
cacgtgccgagcgcgctgggccgcggattcctatgctcgtgcggcaccctcgaggggcac
atcgagccggtcgcgtccggcacggggctgaaggacctctacaatcggcgctgcgaggag
gccggcgacgagaacctcccggctgcggacggcgccgaggtggccgcccgcgcggccgcg
ggggaggagctggcccgccgcacgctcaccgacagcgcccgtgcgctcggcgaatgcgtc
ggcggcatgggcaacctcatcgacccggacgtgatcgtggtctccggctcggtcgtcaag
gccggtccgatctggtgggacgccctgcgcgccgggttcgccgattcggcgctcgcgctc
gtcaagtcgacgccgctcgtcgagggcgagctcggaggggcggcgccgctgatcggcgcg
gcggcggccgtccaccggcgcatcggcgcgccggacaacgcgcgatag

DBGET integrated database retrieval system