KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0175Help
Entry
HMPREF9228_0175   CDS       T01844                                 

Definition
(GenBank) ABC transporter, substrate-binding protein, family 5
  KO
K02035  
peptide/nickel transport system substrate-binding protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF9228_0175
Transporters [BR:bbv02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    HMPREF9228_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
215785..217398
Genome map
AA seq 537 aa AA seqDB search
MENRILIQLSLNEEEKPMYSWKTRMAKTAAAVLAGALALSGCGGGTGTTNAKGGPSVADT
ITAQVAYSSRDFNPLSTSMALPMAGNWHVTEALYTLQMSDYSLVSGLAAGEPEKISDTEY
VITIRDGAKFSDGNAVTANDVKTSFERVMAPGGVYAPMLSFIDSITAQGDNKIDFKLKYA
FTLFKERMSLVHIVPASQSDADLKKMPIGSGPWKYVEITDQQVKFDKNEYYNGEFPAQVS
HMVWNVNVDDTARVTAMQNGKSDIMENVPAKAFDTLKAAGADIETVDGFNQAFIMFNTKQ
KPFDDKRVRQAVFYAIDTESMIKNQLSGEANMVTGFMPESFKAYHKASNVYTYNPEKAKE
LLKEAGVSEGVKFTLYTTDQTWITQLAPQIKNNLDAIGFNVDIQSMKSSALFPTITDKDD
ADFSMVLGPGDPTVFGNDPDVLLNWWFGDTVWTKQRMFWNGSDGYNKLHELMDKAAQSSG
DEQQSYWNECFDLLSDELPMYPLFHRKLSTAVKKNVFSSYTPIGTTGLYFLNSKLNG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcgaatcctgattcagttatcactcaacgaagaggagaaaccgatgtactcg
tggaagacccgaatggccaagaccgccgctgcggtattggccggcgcgctcgccttgagc
ggctgcggtggaggaaccggcacgacgaacgccaaggggggtccctccgtcgcggacacc
atcaccgcgcaggtggcgtacagcagccgtgacttcaatccgctgtccacgtccatggcc
ctgccgatggccggcaactggcatgtgaccgaggcgctgtacacgctgcagatgtccgac
tattcgttggtctccggcttggccgccggcgaaccggagaagatctccgacaccgaatac
gtcatcacgatccgcgatggcgccaagttctcggacggtaacgccgtgaccgccaacgac
gtcaagacctcgttcgagcgcgtcatggcgcccggcggcgtttacgctccgatgctctcg
ttcattgactcgatcaccgcgcagggcgacaacaagattgacttcaagctcaagtacgcg
ttcaccctgttcaaggaacgcatgtcgctggtacacatcgttccggccagtcagagcgac
gcggacctcaagaagatgccgatcggctccggtccgtggaagtacgtcgagatcaccgat
cagcaggtgaagttcgacaagaacgaatattacaacggcgaattccccgcgcaggtctcc
cacatggtgtggaacgtgaatgtggatgacaccgcccgcgtcaccgccatgcagaacggc
aagagcgacatcatggagaacgtccccgccaaggcgttcgacaccctgaaggccgccggc
gccgacatcgagacggtggatggcttcaatcaggcgttcatcatgttcaacaccaagcag
aagccgttcgacgacaagcgcgtgcgtcaggccgtgttctatgcgatcgacaccgagagc
atgatcaagaaccagctgtccggcgaggccaacatggtcaccggcttcatgcccgagagc
ttcaaggcctatcacaaggcctccaacgtgtatacctacaaccctgagaaggccaaggag
ctgctcaaggaggctggtgtgtccgaaggcgtgaagttcacgctctacaccacggatcag
acttggatcacccagctggcgccgcagatcaagaacaacctcgacgcgatcggcttcaac
gtggacattcagtccatgaagtcctccgccctgttcccgaccatcaccgataaggacgac
gccgacttctccatggtgcttggccccggcgatccgaccgtgttcggcaacgatcccgac
gtgctgctcaactggtggttcggcgacaccgtctggaccaagcagcgcatgttctggaac
ggctccgacggctacaacaagctgcatgagctcatggacaaggccgcccagtcctccggc
gacgaacagcagagctactggaacgagtgcttcgacctgctctccgacgagctgccgatg
tacccgctgttccaccgcaagctttccaccgccgtcaagaagaacgtgttcagctcctac
accccgattggaaccactggcctgtacttcctgaactccaagctgaacggctga

DBGET integrated database retrieval system