KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0180Help
Entry
HMPREF9228_0180   CDS       T01844                                 

Gene name
nagB
Definition
(GenBank) glucosamine-6-phosphate deaminase
  KO
K02564  
glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9228_0180 (nagB)
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     HMPREF9228_0180 (nagB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
222429..223241
Genome map
AA seq 270 aa AA seqDB search
MAEVIIVKNQEEAGELYGRSVADLIKAKPNAVLGLATGSSPLAAYQALAEIVKEESIDVS
QVQGFALDEYIGLPLTHPESYHATIHRTVVEPLGLDPAKVHVPGDVLNGTSLEDGEKVAG
AGAAYDAAIEAAGGIDVQILGIGTDGHVGFNEPGSSLASGTRVKTLTERTRIDNARFFDN
DINQVPTHCITQGIGTIMKARHLVLLAFGAGKAEAVAETVEGGISSFCPASALQMHPHAT
IIVDEEAASRLRNKDYYRYSFEHKPAWQTI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtcatcatcgtcaagaaccaggaggaggccggagagctgtacggacgctcg
gtcgcggacctcatcaaggccaagccgaacgcggtgctgggactcgccaccggctccagc
ccgctggccgcctaccaggcgcttgccgagatcgtcaaggaggagtcgatcgacgtctcc
caggtgcagggcttcgcactggacgagtacatcggcctgccgctgacccacccggagtcc
taccacgcgaccatccaccgcacggtcgtcgagcccttggggctcgacccggccaaggtc
cacgtgcccggcgacgtgctcaacggcacttcgctcgaggacggcgagaaggtcgcgggc
gccggcgccgcctacgacgcggcgatcgaggccgcgggcggcatcgacgtgcagatcctc
ggcatcggtaccgacggccatgtgggcttcaacgagcctggctcgtcgctcgcctccggc
acgcgcgtcaagacgctcaccgaacggacccgcatcgacaacgcgcgcttcttcgacaac
gacatcaaccaggtgcccacgcactgcatcacgcagggcatcggcacgatcatgaaggcc
cgccacctcgtgctgctcgcgttcggcgcgggcaaggccgaggcggtcgcggagaccgtg
gagggcggcatcagctcgttctgcccggcctcggcgctccagatgcacccgcacgccacg
atcatcgtggacgaggaggccgccagccgcctgcgcaacaaggactactaccggtactcg
ttcgagcacaagccggcctggcagacgatctga

DBGET integrated database retrieval system