KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0189Help
Entry
HMPREF9228_0189   CDS       T01844                                 

Definition
(GenBank) PAP2 family protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-ProteinID: AEF26846
Position
235584..236768
Genome map
AA seq 394 aa AA seqDB search
MNMNDAQNPVIRDPHAPASMVGGASDARSAADNASDPFAALGSGSAAAGASSNVIDPLAG
LGSPARGPSLGLDDLDPLDSGEVDRGLAKLDPLAVRPRISSRVLCAVFGLLLIAAGFGIW
WVCVFTEDGQSYDELVWKNLVTNVPDAVGGLMSLVAQSWLVIAISCLFAVIGVVSALVHR
RWWLVGQIVVFAVVCLAVTRIKGVLPRPFIINTDSPAANSAPSGHTMLAAACAVILLLAV
PRVARALAGIIGVIWSWAVGVSVIYGQWHRPSDVAMSILLVAGLALIVLAFTRTSGMDEP
GSRVSSVSVQIVSSVLITGGLLLLAYSAYVIWQVVPGLNISASWAVSGSIVSAIVGVAGV
AALTFGLLLALRHITAAPLSRLGLIGAPPAPPQR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatgaatgacgcacagaatcctgtaattcgtgatccgcatgcgccggccagtatg
gtgggaggcgcctctgatgcgcgctccgccgccgataatgcaagtgacccgttcgccgcg
ttgggatcgggctccgctgcggcaggcgcgtcctcaaacgtcatcgatccgctggccggg
cttggctcgccggctcgcggaccgtcgcttgggcttgatgatctcgatccgcttgattcc
ggcgaggtcgaccgtggactggccaagctcgacccgttggctgtgcgcccgcgtatctcc
agtcgcgtgctgtgcgccgtgttcggcctgctgctgatcgcggcgggattcggcatctgg
tgggtgtgcgtgttcaccgaagacggccagtcgtatgacgaactggtctggaagaacctc
gtgaccaatgtgcccgacgcggtcggcggcctgatgtcgctggtcgcccaatcatggttg
gtcatcgccatcagctgcctgtttgcggtgattggtgtggtttcggcgttggtgcatcgc
cgttggtggctcgtcgggcagatcgtcgtgttcgccgtggtgtgcctggccgtcactcga
atcaagggtgtgctgccgcgtccgttcatcatcaatactgattctcccgcagccaattcc
gcgccttccgggcacacgatgctggccgccgcctgtgcggtgattctgctgctcgccgtg
cctcgtgtggcgcgcgcgctggcgggcattatcggcgtgatttggtcttgggccgtcggc
gtatccgtgatatacggccaatggcaccgcccctcggacgtggcgatgtcaatactgctg
gtggccggtctggcgctgatcgtgttggccttcacccggacgtccggcatggacgagccg
ggcagccgcgtctcttccgtaagcgtgcagattgttagcagcgtgctgatcaccggcggc
ctcctactgctggcatacagcgcatacgtgatctggcaggtggttccgggcctgaatatc
agcgcgagctgggcggtgtcgggttcgatcgtcagcgccatcgtgggcgttgccggtgtt
gccgcgctcaccttcggcctgctgctggctttgcggcacatcactgccgcaccgctgagt
cgactgggcctcatcggcgcgcctccagcgcctccacaacggtga

DBGET integrated database retrieval system