KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0193Help
Entry
HMPREF9228_0193   CDS       T01844                                 

Definition
(GenBank) transcriptional regulator, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
Transcription factors [BR:bbv03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    HMPREF9228_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacI Peripla_BP_1 HTH_3 HTH_6
Motif
Other DBs
NCBI-ProteinID: AEF27610
Position
complement(242161..242790)
Genome map
AA seq 209 aa AA seqDB search
MTANEPAESSSVSIVNVAAIANVSTATVSRVLSGKRTKDDDIARRVRAAAHSLNYSVNFA
ASALRSTVTRTIGLIVPSVQDPFSARLIDTLEPLVNQSGRQLALSVGRTPEVQKERIVLM
AARHVDGLIVVPLPGIDLGDVLAQYAQEIPAVQIGGLQHTTFTSDPAPIQPALQQIADEI
LRLLADQSNTPVHVNLPSRLIAPGSQDAE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaacgagccagcggaatcatcatccgtctcaatcgtcaatgttgccgccatc
gccaacgtctccacggccacggtgtcccgcgtgctttccggcaaacgcaccaaggacgac
gacatcgcccgccgcgtgcgagccgcggcccacagcctcaactattcggtgaattttgcg
gccagcgcgctgcgttccaccgtgacgagaaccatcggcctgattgtgccgagcgttcag
gatccgttcagcgcacggcttatcgacacacttgagccgttggtcaaccagagcggccgg
cagctggcgctgagtgtcgggcggacgccggaagtgcagaaggaacgcatcgtgttgatg
gccgcgcgccatgtggatgggctgattgtcgtaccactgcctggcattgatctgggcgac
gtgctggcgcaatatgcgcaggagatccccgccgtgcaaatcggagggttgcagcacacc
acgttcacgtccgaccccgctccgattcagccagcgctgcagcagatcgccgacgagata
ctgcggctgctcgccgatcaatccaatacaccggtgcatgtcaatctgccttcgcggctt
atcgctccgggatcgcaagacgccgaataa

DBGET integrated database retrieval system