KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0204Help
Entry
HMPREF9228_0204   CDS       T01844                                 

Definition
(GenBank) phosphoglycerate mutase family protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MHB
Motif
Other DBs
NCBI-ProteinID: AEF27956
Position
254407..255066
Genome map
AA seq 219 aa AA seqDB search
MSATTIHFVRHGKVYNPDHLLYERLPDFHLSDLGRRMAQATAAYLAKNPQTNTIAAVYSS
PLDRTRETAGAILDALNPVREARGEAPLTLATDERVIEAGNEFRGKRIGHGEGALWKNGN
WKLVTNLYKPSWGESYQHIAQRMDDFAREKVAQHPGEQIVVVSHESPIFSYRHYLETGHP
EHWMFLRHTALASVTSVTYDNETGCVMSITYVDPAANVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaccaccattcatttcgtccggcacggcaaggtgtacaaccccgaccatctg
ctctatgagcggctgcccgacttccatctctccgatcttggccggcgcatggcccaggcc
actgccgcctatctggccaagaacccccaaaccaacacgattgccgccgtgtattcatcg
ccgctcgaccgcacacgtgagaccgccggcgcgattctcgatgccctgaacccggtgcgc
gaagctcgcggcgaagctccgctcaccctcgccaccgatgaacgggtgattgaagcgggt
aacgagttccgcggcaagcggatcggccatggcgagggtgccttgtggaagaacggcaac
tggaagctcgtcaccaacctgtacaagcccagctggggcgagtcataccagcacatcgcc
cagcgcatggatgacttcgcgcgcgagaaggtcgcccagcaccccggcgagcagatcgtg
gtggtcagccacgagtcgccgattttcagctaccgacactatctggagactggccacccg
gagcactggatgttcctgcgccacacggcgcttgcctccgtgacctcggtgacgtacgac
aacgaaaccggctgtgtgatgtcaatcacgtatgttgacccagcggccaacgtcaagtaa

DBGET integrated database retrieval system