KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0219Help
Entry
HMPREF9228_0219   CDS       T01844                                 

Definition
(GenBank) phosphopantetheine attachment domain protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 PS-DH KR PP-binding adh_short adh_short_C2 CdhC
Motif
Other DBs
NCBI-ProteinID: AEF27025
Position
269184..273506
Genome map
AA seq 1440 aa AA seqDB search
MTDRLLTAGAIAEDTRNPIGDIAACFPGHGSQSVGMFHGCLSGFPEARQVIARADDLYKE
RYGERLSTTVGSGRGDRLTMPTVMQPAIVTASLAMFAVLEAAGIPVSMLMGHSLGEYSAL
IASRAVSFEDGFAAVMDRAETIESIPYAMRGAMAVALPRSLHDMHRVRAVVAELSCRGPL
SIAIVNSDEQLVVSGSRALVADVTERLAAESIESFALPIPVGFHSPVLSPVVTEFEHRLE
RYHWNRPDIPVISTITQGTLQPGDVEHLPQLLAGQLVTPFDFRDCIASCRSAGARVFVDM
GPKHIIGTLIEHQLHDGGATVLKLDCGPDGGARTAERIQSLQWLCGTQGNGRKAESEPTK
PAATAPRPTADDVRTALLDALCEATGYPAEVIDPDMDLEADLGIDSVKQMQALGTVAETR
HIGGRRVDLSQARTLNDLSRALSLLQSDEGFRHDERAARTGTIGHATPENETGTGENGTG
LDDLLLRSLCEATGYPAEVIDPDMDLEADLGIDSVKQMQALGTVAERVGIQPESLDLSQA
RTLRQIVECLEHAEPTAPRRQDGRPADEGPHAAEDASGVKRFVPQIIYKPLADDPGLTDW
SDAACLFIRSSDHELDESIRQTLQPLFREVHATTADEIIDSGTHPTVESGTPVRMILDCH
SFHDGIPSFGQRSEAWMRIVRERYARTFRLSQILYPLIEHAEDGMAWLSVTGTGGVSGAG
SKGKGDPLDALDTGFYKSLGKELRNLQVKTMDVDSPDDVPGAILDEVRHYRQDQDCEMGY
LHGRRHVVRVIPMQMRQEHAIRRQLPEGTVAFFSGGSRGIALECAKALADDQPRINVVVT
GRSDVDDPRAQRWLRLSDEEWAQAKPDFIREVKRKDPSLGAIALSEEYDRIGHIRILARN
LRTAVSARRNLHYIPCDIADAQSTEDAVHKARRQWGDLSLVVHAAGLESFGRLPGKTLDR
TMRSIAVKLGGFINLYHATKDEPSLTAFVSFGSVSGRFGMDGQVDYTAAAAALSALSHTI
PMNMPADRRIPFVTMEWSAWGQVGMAVHPQVIAVQEQDRGMEYIPVRTGTEFFLDELALG
TADPEVLIMGSLGSNRPQGQLDSLDDGLELISPIEETTGTVVDKPHYPMLDSVDRQDADT
ILAHRMLRYDRDLYLPDHRVKGVTTFPGVLHLETQIEAASCLSNVKRFGVELEELELNTF
LKCRDNDEVPITVNAHRTDRTDGQVIATELYSTFKTPDGRTLIPHRTHSTAVIRLLDKAP
EPCRADWRPERLLEQGTPVDIGRYHAETEHFISFGPTFRYMRRARLIGDDCAAGEFMVPS
VPGLFSDVRNPQFLCCPLLIDNVGRMALMREFQLRGRHVVPIRIHGARQFRCPAAGELCY
GKMDFLTEDEQGVDVHIEIIDANGYLLCQADDVRLTILGPAEQEHDIMASPDAVEPAKEQ
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgtctcctgacggccggcgcgatagcggaggacacacgcaaccccatcggt
gacatcgcggcatgcttccccggtcacggcagccagagcgtcggcatgttccacggctgc
ctgtccggcttccccgaagcccggcaggtcatcgcccgggccgacgacctgtacaaggaa
cggtacggcgaacgcctttccacgacggttggttccggcaggggcgaccgtctgaccatg
ccgacggtcatgcagcccgccatcgtaacggcctctctggcgatgttcgccgttctcgaa
gccgcaggaatacccgtctcgatgctcatggggcacagtctgggcgaatacagcgcgctg
atcgcctcgcgggcggtatcgttcgaggacgggttcgcggcggtcatggaccgtgcggag
accatcgaatccatcccctatgccatgcgtggcgcgatggcggtcgcattgccgcgcagc
ctccatgacatgcatagggtcagggccgtcgtggccgaactgtcctgccggggaccgtta
tccatcgcaatcgtcaactccgacgagcagctcgtcgtttctggctccagggccttggtc
gcggacgtgacggaacgtttggcggcagagtcgatcgaaagcttcgcgcttcccatcccc
gtgggcttccacagtccggtgctctcacccgtcgtgacggaattcgagcataggctggaa
cggtaccattggaacaggcccgacatccccgtcatctcgacgatcacccagggaaccctg
caacccggtgacgtggagcatctgccgcaactgctcgccggacagctggtcacgcctttc
gatttccgcgactgcatcgcgtcctgccggtccgccggcgcgagggtgttcgtcgacatg
ggacccaaacacatcatcggcaccctaatcgagcatcagctgcacgacggcggggcgacg
gtgctcaagctcgactgcgggccggacggcggagccaggaccgccgaacggatccagtcc
ctgcaatggctctgcggcacgcaggggaacggacggaaggccgagtccgaaccaacgaag
cccgccgccacggcaccgcggccaacggcggatgacgtacgcacggcgcttctggacgca
ttgtgcgaggctaccggctatcccgcggaggtcatcgacccggacatggacctcgaggcc
gatctcggcatcgattcggtcaagcagatgcaggccctgggaacggtggccgaaactagg
catatcggcggccggcgggtcgacctgtcccaggcccgcacgttgaacgacctgtcccgg
gcactctcgctcctgcagtcggatgagggattccgccatgacgaacgggctgcgcggacc
gggaccatcggccatgccaccccggaaaacgaaaccggcacaggcgagaacggcacaggc
ctcgacgatcttctgctgcggagcctgtgcgaggccaccggctatcccgcggaggtcatc
gacccggacatggacctcgaggccgatctcggcatcgattcggtcaagcagatgcaggcc
ctgggaacggtggccgaacgggtcggcatacagcccgaatccctcgacctgtcccaggcc
cggaccctacgccagatcgtcgaatgcctcgaacacgccgagccgaccgccccacgacgg
caggacggccggccggccgacgaaggtccccatgccgccgaagacgcctccggcgtgaaa
cgattcgtcccgcagatcatctacaaaccgcttgccgacgatcccggcctgaccgactgg
tccgatgccgcctgcctgttcatccgatccagcgaccacgagctggacgagtccatccgg
cagacgctccaaccgcttttccgcgaggtgcatgccaccaccgcggacgagatcatcgac
tcgggaacccatcccaccgtggagtccggaacgcccgtcaggatgatcctggactgccac
tcattccatgacggcatcccgtcgttcggacagcggagcgaagcgtggatgcgcatcgtc
cgcgaacgatacgcgcgaacattccgattgtcccaaatcctgtatccgctgatcgaacac
gcggaggacggcatggcatggctgtcggtcaccgggacgggaggcgtctcgggagcggga
agcaaagggaagggcgatccgctggacgcgttggacacgggattctacaagagcctcggc
aaggaactgcgcaacctgcaggtcaagaccatggacgtggattcccccgacgacgtgccc
ggcgccatcctggacgaagtgcgccactaccggcaggaccaggactgcgagatgggatac
ctgcatgggcgacgtcacgtggttcgcgtgattcccatgcagatgagacaggagcacgcg
attcgcaggcagctgccggaaggaaccgtggccttcttctccggaggatcgcgcggcatc
gcgttggaatgcgccaaagcccttgccgacgaccagccgcggatcaacgtcgtggtcacg
ggacgatccgatgtcgacgacccccgggcgcaacgctggcttcgcctgagcgacgaggaa
tgggcgcaggcgaagcccgacttcatccgcgaagtcaagcggaaggatccctcgctcggg
gcgattgcgctgtcggaggaatacgatcggatcggccatatccgcatcctcgcacggaac
ctcaggaccgccgtatccgcacgacgcaacctgcactacattccctgcgacatagcggac
gcgcaatccacggaggacgcggtccataaggcccgcaggcaatggggggacctttcgctc
gtggtccacgccgccggactggaatcattcggcagactgcccggcaagaccctggaccgt
accatgagaagcatcgcggtcaaactcggcgggttcatcaacctgtatcacgccaccaag
gacgaaccgtcactgaccgccttcgtctccttcggatcggtctccggacgtttcggcatg
gacgggcaggtcgactacactgccgccgccgccgcgctttccgcactctcccacacgatc
ccgatgaacatgcccgccgaccggaggatcccgttcgtgacgatggaatggtcggcatgg
gggcaggtcggcatggccgtccatccgcaggtgatcgccgtgcaggagcaggaccgcgga
atggaatacattcccgtcaggaccggcacggaattcttcctcgacgagctcgcgctcggc
acggcggaccccgaggtgctgatcatgggctcattgggttccaacaggccgcagggacaa
ttggattccctggacgacgggctggaactgatctcacccatcgaggaaaccacgggcacc
gtcgtggacaagccccactatccgatgctcgacagcgtcgacaggcaggatgcggacacc
atcctcgcccatcggatgctccgatacgaccgtgacctgtacctgcccgaccaccgggtg
aagggcgtcacgaccttccccggggtgcttcacctggaaacgcagatcgaagccgcctca
tgcctgtccaacgtgaaacggttcggcgtcgaactcgaggaactcgaactgaacacgttc
ctcaaatgccgcgacaacgacgaggtcccgatcacggtcaacgcccatcgcacggaccgt
acggacggccaggtcatcgcgacggaactgtactcgacattcaaaacgcctgacggcagg
accctcatcccccaccgcacccattcgacggccgtcatcagactgctggacaaagccccc
gaaccatgtcgggcggattggcggccggaacgcctgctcgaacagggaacgcccgtcgac
atcggccgatatcatgccgaaaccgaacatttcatcagtttcggaccgaccttccggtac
atgcgcagggcacggctgatcggcgatgactgcgcggcgggcgaattcatggtgccatcc
gtgccggggcttttcagcgacgtacgcaacccgcagttcctctgctgtccgctgctgatc
gataacgtcggcaggatggcgctgatgcgtgaattccagctcaggggacggcatgtggtg
ccgatccggatccacggggcccgccagttccgctgccccgcggcgggggaactgtgttac
gggaagatggatttcctcaccgaggacgagcagggcgtcgacgttcatatcgagatcatc
gacgccaacggatacctgctctgccaggcggatgacgtgcggctcaccatcctgggtccg
gcggaacaggaacacgacatcatggcatcccccgacgccgtcgaacccgcaaaggagcaa
tga

DBGET integrated database retrieval system