KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0221Help
Entry
HMPREF9228_0221   CDS       T01844                                 

Definition
(GenBank) 4'-phosphopantetheinyl transferase family protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-ProteinID: AEF27255
Position
complement(276933..277580)
Genome map
AA seq 215 aa AA seqDB search
MMCADLMMRRARLFGPLLASGCEVLISGEGTRRVRLFDGERALVGNAKAKRRREFTETRL
LAHEALRRIGHDGPILKGSDGEPLWPSGIVGSLSHCPSLCVAAVASAERIRAVGVDVDDS
DGLSDGIMRFVFSSEELASLRMASSVERRAAFCAKEAASKALPALDGTGDFRKVSVSLKT
DGTFAAVRRDVALRSQWRFYDRLVSAMVAVPSETV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcgcagacctcatgatgcgacgggctcgcctgttcgggccgctgctcgcctcc
ggctgcgaggtgctgatctcgggggaggggacgcgccgcgtgcgattgttcgacggtgag
cgggccttggtcgggaacgccaaggccaaacgaagaagggaattcacggagacgcgtctt
ttggcccacgaggccttacgacgtatcggccatgacgggcccatactcaaaggttcggat
ggtgaaccgctctggccatccggcatcgtgggatcgctgtcgcattgtccgtcgctgtgc
gtcgccgccgtggcgtcggcggaaagaatccgtgccgtgggagtggacgtggacgattcg
gacggattgtccgacgggatcatgcggttcgtgttctcttccgaagagctcgcatcattg
cgtatggcctcctcggtggaacgtagggcggccttctgcgcgaaggaggccgcctcgaag
gcgttgcccgcattggacgggacgggggacttccgtaaggtatccgtgagcctgaagacg
gatggaacgttcgccgctgtgagacgggatgtggcgttgcgcagccaatggcgattctac
gatcggctggtatccgcgatggtcgccgttccctcggagaccgtctga

DBGET integrated database retrieval system