KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0228Help
Entry
HMPREF9228_0228   CDS       T01844                                 

Definition
(GenBank) FRG domain protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FRG
Motif
Other DBs
NCBI-ProteinID: AEF27670
Position
complement(285952..287460)
Genome map
AA seq 502 aa AA seqDB search
MKNRSAQSNGNNSIYYQAMLKDEEHHEHVSALPSIAKITQATPNLMAISPNMTHQLLDTI
QKTPEISNNLRLISTPLETSTSAIQTFLEQQEKALKTISNLSSSTILSSIKPIQDSLRDA
LAKFDFAHYDEKYLNVYSGISQVLKQYEETQSNLQKYYRSITPSYFHSSNESPHYYSPEM
TSPSDFFDSKSGRIESIEDLNNAILLLQKHVSNIPLYWRGQNNASWGLHSKLFRLLMTQN
GVVSPQQKPKTKQPYPTEDQMIHAEKQILNLARQDWRYGNMSALEIFARIQHFGGPTRLL
DASCNPYIAAWFAVYDPTHEHEDHDARLFALAGYASGNNEQPDYSEELLSRDPFWFNLHD
YEQRAAANWGTGSRRIVWRPPEYESRIAAQNAVFILDGIPITNSRILQYFRKPTGKEYWK
RPDILAASSIYAKPFSPNHNARPNQRNLAPTYSFVIAKKAKKEIRSYLEGAFGYRESFIY
PDFAGLASKTNNIQFPNLGDLQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccgatcagcacaatccaatggcaacaactcgatatactatcaagccatgctt
aaggatgaagaacaccatgaacatgtaagcgcgttgccgtctatagcgaaaataacgcaa
gcaacgccgaatctaatggcaataagccccaacatgacgcatcagctgctagataccatt
caaaaaaccccagaaatcagcaacaacctgcgacttatatccactcccctcgaaacaagc
acttcagcaattcaaactttcctagagcagcaagagaaagccctcaaaacaatctctaac
ttatcttcaagcacaatcctgtcttccataaaacctattcaggacagccttcgtgacgca
ctagcaaaatttgattttgctcattacgacgaaaaatatctgaacgtatattccgggatt
tcgcaagtattaaaacaatatgaagagacacaatcaaacctgcaaaagtattatcgatcc
ataacccctagttatttccatagctctaacgagtcacctcattactactctcctgagatg
accagtccttcagatttttttgactccaaaagtggacgcatcgagagtatagaagattta
aataatgcaatccttctactgcaaaagcatgtatcaaatataccgttatactggcgagga
caaaataatgcctcttggggactacatagcaaattatttcgcctactaatgacgcaaaat
ggagttgtttcccctcagcagaagcccaaaaccaaacagccctatccgaccgaagaccag
atgattcacgctgagaagcagattcttaatcttgctcgtcaagactggcgatatggaaac
atgtctgctttagagatattcgcacgcattcagcactttggcggccccacacgcctactc
gacgcatcctgcaacccatatatagctgcttggttcgccgtctatgacccaacgcacgag
cacgaagatcatgacgcgcgcctattcgctttagctggatacgcatcaggcaataatgag
caaccagactactccgaagaactgctaagtcgcgaccctttctggttcaacctgcacgat
tacgagcaacgcgcagcagccaactggggaaccggatcacgccgtatcgtatggcgtcca
ccagaatacgaatcacgtatcgctgctcaaaatgcagtatttatcctcgatggaattcca
attacaaatagtcgaatccttcaatattttcgcaagcctacgggcaaagaatattggaag
aggccagatatactcgcagcttcctcaatttatgcaaagcccttctcgccaaatcacaac
gcacgtccgaatcaacgcaatctagcaccaacgtattcattcgtcattgccaagaaagcc
aagaaagagatacgaagttacctagaaggcgcgtttggataccgcgagtccttcatctac
cccgatttcgcaggcctagcaagtaaaacaaacaatatccagttcccaaatctaggtgat
cttcaatag

DBGET integrated database retrieval system